KEGG   Granulosicoccus antarcticus: IMCC3135_20605Help
Entry
IMCC3135_20605    CDS       T04938                                 

Gene name
nagL_1
Definition
(GenBank) Maleylpyruvate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00350  Tyrosine metabolism
gai00643  Styrene degradation
gai01100  Metabolic pathways
gai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    IMCC3135_20605 (nagL_1)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    IMCC3135_20605 (nagL_1)
Enzymes [BR:gai01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     IMCC3135_20605 (nagL_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_N_4 GST_C
Motif
Other DBs
NCBI-ProteinID: ASJ74198
UniProt: A0A2Z2NWS6
Position
4672164..4672802
Genome map
AA seq 212 aa AA seqDB search
MSETILYDYWRSTASYRVRIALNLANIPYQSVSVDLVAGDHRKPEHLILNPQGLVPVLEI
DGERFTQSLAIIDYLDATRNLGLLPQNPILRTKVQALAQAIAVDLHPVCNLGVVKHATNG
EEPARTEWMQHFITPGLKAFDTLLKDFEQIPFCTGSTPSLADICLIPQLYNAQRWGADYA
GCSRIIQAADACAEHPAFIAAHPDAVANAVKS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaccattctctacgactattggcgatcaacggcaagctatcgcgttcgtatc
gctctgaatttagcgaatatcccttaccaatccgtatcggtagatctggttgcgggcgat
catcgcaaacccgaacatctgatcctcaaccctcagggactggttccggtacttgagatt
gatggtgaacgatttacacaatcactggccattatcgattatctggatgccaccagaaac
ctgggcttgttgccacagaacccgatcctgcgcactaaagtacaagccctggcacaagcc
atcgcagtcgatctgcatccggtctgtaatctgggcgtggtcaaacatgcaaccaacggt
gaagagcctgctcgaaccgagtggatgcagcatttcatcacgccgggactaaaagccttt
gacactctgctgaaagacttcgagcagattcctttttgtaccggcagcacacccagcctg
gccgacatctgccttattccccagttgtacaacgcgcaacgctggggagctgactatgca
ggatgctcacgcatcattcaggcggctgatgcctgtgctgaacaccctgcttttattgcc
gcacatcctgatgcggttgcaaacgcggttaaatcctga

DBGET integrated database retrieval system