KEGG   Granulosicoccus antarcticus: IMCC3135_23135Help
Entry
IMCC3135_23135    CDS       T04938                                 

Gene name
glcB_3
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00620  Pyruvate metabolism
gai00630  Glyoxylate and dicarboxylate metabolism
gai01100  Metabolic pathways
gai01110  Biosynthesis of secondary metabolites
gai01120  Microbial metabolism in diverse environments
gai01200  Carbon metabolism
Module
gai_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC3135_23135 (glcB_3)
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC3135_23135 (glcB_3)
Enzymes [BR:gai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     IMCC3135_23135 (glcB_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ASJ74696
UniProt: A0A2Z2NT68
Position
complement(5257334..5259511)
Genome map
AA seq 725 aa AA seqDB search
MSVKTAGGLTVASSLHDFIVNEALPGTGIEADALFTSLAGILAELGPRNEAALARRDQIQ
AQLDEWHKAHPGAVDAVAYKAFLVEIGYLEPIVEDFSVQVSKVDAEIATIAGPQLVVPVN
NARYALNAANARWGSLYDALYGTDAISEADGAERKKEYNPIRGQRVVALANQLLNDSAPL
VQNGYADVTSYAIVDGALKLTLASGSEVGLKNPQQCVGYTGDAAMPASVLLQNNGLHMEI
VFDKTSPVGRASAAGVSDVIMESALTTIQDCEDSVTAVDADDKVLVYRNWLGLMKGDLAE
QVEKNGKQLVRKLNPDRGYIDMQGNGMTLPGRSVLLVRNVGTHMLTDSVLDADGKQVPES
YLDAMFTSLIAMHDLKKGETDARNSRAGSVYIVKPKQHGSDEVALSVKLFSMVEEALGLA
ANTVKMGIMDEERRTSVNLKNCISAARERVIFINTGFLDRTGDEMHTSMYAGVMVPKGEM
KNSTWLAAYEDNNVDVGLASGLQGNGQIGKGMWAIPDQMAAMLAAKQAHPEAGANTAWVP
SPTAATLHAMHYHKVDVHAVQETLKSRQKASVDAILTIPLSEQGRNFSTEEIQHELDNNS
QSILGYVVRWVNQGVGCSKVPDINDVGLMEDRATLRISSQFLANWLQHEIITIEQVRNAM
ERMALVVDGQNANDAGYTAMAPNFQDSIAFQAALDLVLLGREQANGYTEFVLTERRRQVK
AAAAI
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaagactgctggcggtttgacagtcgcttcatccctgcacgatttcattgtt
aatgaagcactgccgggcacgggcatcgaagccgatgcacttttcacctctctggcaggc
attctggctgagctggggcctcgtaatgaggcggcattggcgcgccgtgatcagattcag
gcacagttggatgagtggcacaaagcgcatcctggtgctgttgatgcggttgcctacaag
gcttttctggtcgaaattggctatctggagccgatcgtcgaagatttcagtgtgcaggtt
tccaaagtggatgctgagatcgccaccattgcgggtccgcagctggttgtacccgtcaat
aacgcacggtatgcactgaatgccgccaatgcacgttggggcagtctgtatgacgctctg
tacggtactgatgctatcagcgaagctgatggtgccgaacgtaaaaaggaatacaacccg
attcgcggtcaacgggtcgtggcactggccaaccagctgctgaatgactctgctccattg
gtccagaacggatatgccgatgtaaccagctatgccattgtcgatggtgcgttgaaactg
acgctggcatcgggcagtgaagtcggtttgaaaaacccacagcaatgtgttggctatacg
ggtgatgcggccatgcctgcctcggttctgctgcagaacaacggcctgcacatggaaatc
gtctttgataaaaccagcccggttggccgtgccagcgcggcaggagtctccgatgtcatc
atggaatcggctctgacgaccatccaggattgtgaagactcggtgacagccgtggatgcg
gatgacaaggtactggtttatcgcaactggctgggcctgatgaaaggtgacctggctgag
caagtcgagaagaacggcaagcagctggttcgcaagctgaacccggatcgaggctatatc
gatatgcagggcaatggcatgacattaccaggtcgtagcgtactgctggtgcgtaatgtg
ggtacccatatgctcacagattcagtactcgatgctgatggcaagcaggttccagaatcc
tacctggatgcgatgttcaccagtcttatcgccatgcacgatctcaagaagggcgagaca
gatgcgcgtaattctcgcgcaggaagtgtctatatcgtcaagccaaaacagcatggttcc
gatgaagtagccctgtcagtcaagctcttttccatggttgaagaagctctgggtctggcg
gcaaacacggtgaagatgggcatcatggatgaagagcgccgcacctctgtcaatctgaaa
aactgtatttcagcggctcgcgagcgtgtcattttcatcaataccggtttccttgatcgt
accggtgatgagatgcataccagcatgtacgccggtgtcatggtgcccaagggcgagatg
aagaactcgacctggttggctgcctatgaagacaacaacgtggatgttggcctggcttct
ggtctgcagggtaatggtcagatcggtaaaggcatgtgggcaataccggatcagatggca
gccatgttggcagccaagcaggctcatccggaagcgggtgccaataccgcctgggtacct
tcgccaactgccgccaccttgcatgcaatgcattatcacaaggtagatgtgcatgcggtt
caggaaactctgaagagccgccagaaggccagcgttgatgccatcctcaccattcctttg
agtgagcagggacgcaacttctcaactgaagaaattcagcatgagctggacaacaactca
caaagtattctgggttatgtggttcgctgggtaaatcagggtgtgggctgttccaaggtg
ccagatatcaatgatgtgggcctgatggaagatcgtgccacattgcgtatatccagccag
tttctggctaactggttacagcacgagatcatcaccatcgagcaggttcgtaatgccatg
gaacgcatggcgctggttgttgatggacagaatgccaatgatgctggctacacggccatg
gctccgaactttcaggacagcatcgcctttcaggctgcgctggatctggtactgctgggg
cgggaacaagcgaatggctataccgagtttgttctgacagagcgtcgtcgacaggtcaaa
gctgccgccgcgatctaa

DBGET integrated database retrieval system