KEGG   Granulosicoccus antarcticus: IMCC3135_26600Help
Entry
IMCC3135_26600    CDS       T04938                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00071  Fatty acid degradation
gai00072  Synthesis and degradation of ketone bodies
gai00280  Valine, leucine and isoleucine degradation
gai00310  Lysine degradation
gai00362  Benzoate degradation
gai00380  Tryptophan metabolism
gai00620  Pyruvate metabolism
gai00630  Glyoxylate and dicarboxylate metabolism
gai00640  Propanoate metabolism
gai00650  Butanoate metabolism
gai00900  Terpenoid backbone biosynthesis
gai01100  Metabolic pathways
gai01110  Biosynthesis of secondary metabolites
gai01120  Microbial metabolism in diverse environments
gai01130  Biosynthesis of antibiotics
gai01200  Carbon metabolism
gai01212  Fatty acid metabolism
gai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC3135_26600
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC3135_26600
   00640 Propanoate metabolism
    IMCC3135_26600
   00650 Butanoate metabolism
    IMCC3135_26600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IMCC3135_26600
   00072 Synthesis and degradation of ketone bodies
    IMCC3135_26600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IMCC3135_26600
   00310 Lysine degradation
    IMCC3135_26600
   00380 Tryptophan metabolism
    IMCC3135_26600
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IMCC3135_26600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IMCC3135_26600
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IMCC3135_26600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gai04147]
    IMCC3135_26600
Enzymes [BR:gai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IMCC3135_26600
Exosome [BR:gai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IMCC3135_26600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASJ75375
Position
6076770..6077966
Genome map
AA seq 398 aa AA seqDB search
MKIMPTDPIVIVEAARTPMGGFQGDLSPVSATELGAVSIRAILERTGINVEEIDEVIMGC
VLPAGLGQAPARQASLAAGLPDSVGCSTVNKMCGSGMKATMFAHDQLLAGTNKIVVAGGF
ESMSNAPYLLPKAREGLRMGHGEVKDHMFLDGLEDAYETGKLMGHFAELTATHYQFTREA
QDAFAITSLQRARQAIESGAFSREIAPVTVKSRKGDTQILHDEQPPKANLERIPGLRAAF
AKDGTVTAANASSISDGSAAMLLMRESEAERRGLTPRARILAHATHAQAPAWFTTAPVYA
MEKLLAKIGRQASDIDLYEINEAFAVVTMAAMHELKLPHEKVNVHGGACALGHPIGASGA
RILVTLLHALEHHSLSLGMASLCIGGGEATAVAIERVI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatgcccaccgaccccatcgtcatcgtagaagccgcccgcaccccgatgggg
ggattccagggagacctgtcgccggtttcagcaaccgagctgggtgccgtcagcattcgg
gcaatactggaacgtaccggcatcaacgtcgaggagattgacgaagtcatcatgggctgc
gttctgcctgccggtcttggccaggcgccggcccgccaggcatctctggcagccggcttg
cccgactctgttggttgttcaacggttaacaaaatgtgtggttctggcatgaaggccacc
atgttcgctcatgaccagctgctggctggcaccaacaagattgtggtggcaggtggtttt
gaaagcatgagcaatgctccctacctacttcccaaggcccgggaaggtttgcgtatgggg
cacggcgaggtcaaagatcatatgttcctcgacggcctggaagatgcctacgagactggc
aagttgatgggccacttcgccgagctcacggccactcattatcaatttacacgtgaagct
caggatgcctttgccatcacatcgttgcaacgtgctcgacaggcaattgagtctggcgcg
ttttcccgcgaaattgcgccggttaccgtcaagagtcgcaaaggcgacacacagattttg
cacgatgagcaaccgcccaaggccaacctggaacgcatacccggactgcgcgccgccttt
gccaaggacggtaccgtcaccgctgccaacgccagctccatatccgatggctctgcagcc
atgctactgatgcgtgagtccgaagccgagcgacgcggcctgacgccacgagcccgcatt
ctggcacacgcgacccatgcgcaggcacccgcctggttcaccacggcaccggtctatgcg
atggaaaaattactggcaaaaataggccgacaagccagtgatatcgacctgtatgagatc
aacgaagccttcgctgtcgtcaccatggccgccatgcacgaactcaaactgccgcatgag
aaggttaacgttcatggcggtgcctgtgctctgggccatcccattggtgcctcaggtgcg
cgcattctggttaccttgttgcacgcactcgaacatcattcgctatctctgggcatggcc
tctctgtgtatcggtggcggcgaagcaacagcagttgcaatagagagagtcatatga

DBGET integrated database retrieval system