KEGG   Glycocaulis alkaliphilus: X907_0434Help
Entry
X907_0434         CDS       T05786                                 

Definition
(GenBank) two component transcriptional regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
gak  Glycocaulis alkaliphilus
Pathway
gak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gak00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X907_0434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gak02022]
    X907_0434
Two-component system [BR:gak02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   X907_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AZU02982
UniProt: A0A3T0E6N9
Position
441779..442495
Genome map
AA seq 238 aa AA seqDB search
MTGLPPETHILVVDDDDRIRTLLSRFLRERGFRVSSAPNADKALSMLRSLAFDLLILDVM
MPGMDGFELTRAVREAHDCPILLLTARGEPEDRIKGLSLGADDYLAKPFEPEELILRVQA
ILRRMIPKKLGARRVRFGSWIFELETGQLLQGEARVRLTGGEAALLTALAQSPGEPVDRF
LLSERAAGGAGERAIDVQMTRLRRKIEDDPKNPVFLQTVRGEGYKLVAEPVFEAPAGK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaccggactgccgcctgaaacccatatactcgtcgtcgatgatgatgaccgtatccgc
acgctcctgagccgcttcctgcgtgagcggggctttcgcgtgtcctccgccccgaatgcg
gacaaggcattgtcgatgttgcgctcgctcgcctttgacctgctcatcctggatgtgatg
atgcccggcatggacggatttgaactgacgcgtgccgtgcgcgaggcccatgattgcccg
atcctgcttttgaccgcgcgcggcgaacccgaagaccggatcaagggcctgtcactgggc
gccgacgactatctggccaagcctttcgagcctgaggagctgatcttgcgcgtgcaggca
attctgcgccgcatgatccccaagaagctgggggcaaggcgcgttcgcttcggcagctgg
atattcgagctggaaaccggccagctcctgcagggcgaggcgcgtgtgcgcctgaccggc
ggcgaggcggccttgctgacagcccttgcccagtcgcccggagagcctgtcgaccgtttc
ctgctgtccgagcgggcggcgggcggcgcaggggagcgtgcgattgacgtgcagatgacg
cgcctgcgccgcaagatcgaggatgatccgaaaaatcctgttttcctccagacggtgcgc
ggtgaaggctataagctggtggccgagccggtattcgaggccccggcgggaaagtga

DBGET integrated database retrieval system