KEGG   Glycocaulis alkaliphilus: X907_1623Help
Entry
X907_1623         CDS       T05786                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
gak  Glycocaulis alkaliphilus
Pathway
gak00380  Tryptophan metabolism
gak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    X907_1623
Enzymes [BR:gak01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     X907_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C Imm30
Motif
Other DBs
NCBI-ProteinID: AZU04155
UniProt: A0A3T0E9N1
Position
1682994..1683842
Genome map
AA seq 282 aa AA seqDB search
MSEHFPTSVNLEGEDIHWSPEGGLSYGRYLVLDRILGAQSPLTEEHDEMMFIIIHQASEL
WLKLCLHELEAAIAHVQADEVRPAMKMLARIARIQEQLTQSWAVLSTMTPSDYLKFRDQL
GQSSGFQSAQYRTLEYRLGNKNAALAKVHASDEEAHTLVSKALVQPSLYDETLRFAARSG
LTVPSTAIERDWSQPYQPDDAVEAMWREVYLDTGKWWEVYEFAEKLVDLEQKFQQWRFNH
MKTVERIIGFRRGTGGSGGVSYLVKALNLRLFPELWTVRTTL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacatttccccacttcggtgaacctcgaaggcgaggatattcactggtccccg
gaaggcgggctcagctatggccgctatctcgtgcttgaccgcattctcggcgcgcagtcc
ccgctgaccgaagagcatgacgagatgatgttcatcatcatccaccaggccagcgagctg
tggctgaaactgtgcctgcacgagctggaggcggcgatagcccatgtacaggcggatgaa
gtccgcccggccatgaaaatgctggcgcgcattgcccgcatccaggagcagctgacccag
tcctgggcggtgctgtcgacgatgacgccgtctgactatctgaaattccgtgaccagctg
gggcaaagttcaggcttccagtcagcccagtaccgcacgctggaataccggctcggcaac
aagaatgcggcgctggccaaggtgcatgcctccgacgaagaagcgcacacgcttgtcagc
aaagccctcgtgcagccaagcctttacgacgaaaccttgaggtttgctgccagatccggc
ctgactgttccctccacagctatcgaacgcgactggtcccagccttatcagcccgacgac
gccgtagaggcaatgtggcgagaggtgtatctcgacaccgggaaatggtgggaagtatat
gaatttgccgagaaacttgttgatctggagcagaagttccagcaatggcgtttcaaccat
atgaaaacggttgagcggattatcggcttccggcgcggcacaggcgggtccggcggggtg
tcctacctcgtcaaagcgttgaacttgcgtctgttccccgaactctggaccgtgcgcacc
acactctag

DBGET integrated database retrieval system