KEGG   Gluconobacter albidus: A0U94_00405Help
Entry
A0U94_00405       CDS       T04736                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gal  Gluconobacter albidus
Pathway
gal00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A0U94_00405
Enzymes [BR:gal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A0U94_00405
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A0U94_00405
    1.1.1.-  
     A0U94_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA FAD_binding_3 NAD_binding_8 DAO Pyr_redox_2 Trp_halogenase Pyr_redox FAD_oxidored 3HCDH_N TrkA_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AQS89672
UniProt: A0A1U9KV69
Position
complement(93906..94931)
Genome map
AA seq 341 aa AA seqDB search
MLAARFSGIGDIKVLPVPISQDLPDGCVRIRVEAAGICGSDLHNFQTGQWLSRCPVTPGH
EFSGTITQTSGNCGSLTVGTPVIADSRVGCGTCQSCRSGRKNLCRNLSFVGESCDGGFAQ
DVILPATQVLPFPDTLPLRYGALVEPLSVSLHAVHRLAPTPGSPVVICGGGTIGGLAALL
LRQQGHDVHLLERNIGRQTLLTETIGMLPLPPDAEDWNTLFGPEGPAFILDATGAAPVVE
MACQRLAPGGRLVLAGIFHHTPRIDLNLIVERELDIRGVSAFADEMPEAIQRLPGLVPFL
DRLITPAAALTDLPALYTHLLSGAEKRLKTLIAPNGTDGTW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgctgcccgtttttccggcatcggagacattaaggttctccctgtcccgatatcg
caggacctgccggacggctgtgtccgcatccgggtcgaagcagcggggatctgcgggtcc
gacctgcacaatttccaaaccgggcagtggctttcccgctgtcccgtcacaccgggccac
gaattttccggaaccatcacccagaccagcggcaattgcggttcactgacagtcggcaca
cccgtcatcgcggattcaagagtcggctgcggaacctgccagtcctgccgctccggccgg
aaaaacctgtgccggaacctcagcttcgtcggagaaagctgcgacggcggcttcgcacaa
gacgtcattctgccagccactcaggtcctgcctttccccgacactctccccctgagatac
ggggcccttgtcgaaccgctctccgtctccctccacgccgtccaccgcctcgccccgaca
cccggttctccggtcgtcatctgcggcggcggtacgatcggcgggctggccgccctcctg
cttcggcagcagggccatgacgtccatctgcttgaacgcaacatcgggcgccagacgctc
ctcacggaaaccatcggcatgcttcccctccctccggacgcagaagactggaacaccctg
ttcggcccagaaggccccgcgtttattctcgacgccaccggcgccgcccccgttgtggaa
atggcctgccagcgcctcgctccgggcggcaggctcgtgctggccggcattttccatcac
acaccccggatcgacctcaacctgatcgtggaacgggaactcgacatccggggcgtcagc
gctttcgcagacgaaatgcccgaggccatccagcgtctccccggcctcgttccgtttctc
gaccgtctgatcactccggccgcagccctcaccgatctgccggccctctatacccatctg
ctctcaggcgcggaaaagcgcctgaaaaccctgatcgcccccaacggtacggacggaaca
tggtaa

DBGET integrated database retrieval system