KEGG   Gluconobacter albidus: A0U94_02430Help
Entry
A0U94_02430       CDS       T04736                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
gal  Gluconobacter albidus
Brite
KEGG Orthology (KO) [BR:gal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A0U94_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Cu-oxidase_3
Motif
Other DBs
NCBI-ProteinID: AQS90003
UniProt: A0A149T0I6
Position
complement(565751..566224)
Genome map
AA seq 157 aa AA seqDB search
MPDKSSHPLLHADPETALAEAMETAPCFSKTTDDVTVTVRTFWLDDQSHPEDHQYAWAYH
ISIENERKDTFQLLSRSWEIVDGLGRKEHVHGDGVVGEQPVIAPQEQFDYTSGAMLTTPS
GFMHGTYHMLEPRSGHRFDVSIPVFSLDSPHDSTLIH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaagtcatcccacccccttctccatgccgaccccgaaacggcactcgccgaa
gccatggaaactgcaccatgcttcagcaaaacaacggacgacgtgacagtcacggtccgg
accttctggctggacgaccagtcccatcctgaagaccaccagtacgcctgggcctatcac
atcagcatcgagaacgagcggaaagacaccttccagctcctgtcccggagttgggaaatc
gtggatggactgggccgcaaggagcatgtccatggcgatggcgtcgtcggcgaacagccg
gtgatcgccccgcaggaacagttcgactacacatccggcgcaatgctgaccacgccctcg
ggattcatgcacggcacctatcatatgctggagccgcgttcgggccatcgcttcgacgtc
agcatccccgtgttcagcctcgacagcccccacgacagcacgctgatccactga

DBGET integrated database retrieval system