KEGG   Gluconobacter albidus: A0U94_02950Help
Entry
A0U94_02950       CDS       T04736                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
gal  Gluconobacter albidus
Pathway
gal00860  Porphyrin and chlorophyll metabolism
gal00970  Aminoacyl-tRNA biosynthesis
gal01100  Metabolic pathways
gal01110  Biosynthesis of secondary metabolites
gal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A0U94_02950
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A0U94_02950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gal01007]
    A0U94_02950
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gal03016]
    A0U94_02950
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:gal02048]
    A0U94_02950
Enzymes [BR:gal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     A0U94_02950
Amino acid related enzymes [BR:gal01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A0U94_02950
Transfer RNA biogenesis [BR:gal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A0U94_02950
 Prokaryotic type
   Other AARSs
    A0U94_02950
Prokaryotic defense system [BR:gal02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    A0U94_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AQS90094
UniProt: A0A1U9KW80
Position
684112..685446
Genome map
AA seq 444 aa AA seqDB search
MKLRFAPSPTGYLHVGNARLAVANFLFARHNGAKFLLRIDDTDTSRGKPEYEEAIGKDLS
WLGLKWDEYVRQSERLDRYAEVIEKLKATGRLYPCFETEYELNAKREARIRCGKAPIYDR
AMLKLTADQRARAEANGKTPHWRFRLSDGSRKWNDLVMDECSVKLTAISDPVLVRGDGTI
LYTLASVIDDLDMGITHIVRGEDHVTNTGVQIDIAEALGAKPNRFTFAHLPLLLDSDGGK
LSKRFDSLALKSLRQDGLEPMSIVSYLARVGSSDDPQVMTMDEAVAAYDISHVSKSAARF
DMTQLLALNRRALHSLPFEAAKAHLPPEADETFWNAVRGNVDLSAEIPHWWDVVHGTIVP
PSQPEDREFLQQALDTLPAEPWGEDTWKDWTNTLKEAAGRKGRTLFMPLRLALTGEDAGP
ELYVLLGLMGRERTVARLRDAIQA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgcttcgctccgtccccgaccggttacctgcatgttggcaatgcgcgcctt
gccgtcgccaacttccttttcgcacgccataacggcgcaaaattcctgctgcggatcgac
gataccgataccagccggggcaagcccgaatatgaagaggcaatcggcaaggacctgtct
tggctggggcttaaatgggacgagtacgtccgccagtccgagcggctggaccggtatgcc
gaagtcattgaaaagctgaaggcaacaggccgtctttatccctgctttgaaacggaatac
gagctgaacgccaagcgcgaagcccgcatccgctgcggcaaggcgcccatctacgaccgc
gccatgctcaagctcacggccgatcagcgtgcccgcgctgaagccaacggcaagacgccg
cactggcgcttccgcctcagcgatggtagccgcaagtggaacgatctcgtcatggacgag
tgctcggtcaagctgacggccatttccgatccggttctggtgcgtggggacggcacgatc
ctctacacgctggcctccgtgatcgacgatctggacatgggcatcacccatattgtccgc
ggcgaagatcatgtgaccaataccggcgtgcagatcgacattgccgaagccttgggtgcc
aagcccaaccgcttcaccttcgcgcatctgccgctgttgctggattccgatggcgggaag
ctgtcgaagcggttcgactcgctcgcgctgaaatccctgcgtcaggacgggctggagccg
atgtcgatcgtctcttatctcgcccgtgtgggatcgtcggatgatccgcaggtcatgacg
atggacgaggccgtggcggcttatgacatctcgcatgtttccaagtcggccgcgcggttc
gacatgacgcagcttctcgccctgaaccgccgtgcgctgcacagcctgccgttcgaggct
gcgaaggcgcatcttccgccagaagccgacgagacgttctggaatgccgtgcgcggaaat
gtggacctctccgccgagatcccgcactggtgggacgtggtgcatggcacgatcgtcccg
ccgtcccagcccgaagatcgtgagtttcttcagcaggccctcgacactctgccggccgag
ccgtggggcgaggacacctggaaggactggaccaatacgctcaaggaggccgcgggccgt
aaggggcgtaccctcttcatgccgctgcgtctggccctgacgggtgaagatgccggtccg
gaactgtacgttctgctcggcctgatggggcgcgaacgcacggtggcccgtctgcgggac
gccattcaggcctga

DBGET integrated database retrieval system