KEGG   Gallibacterium anatis: UMN179_00309Help
Entry
UMN179_00309      CDS       T01482                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
gan  Gallibacterium anatis
Pathway
gan00790  Folate biosynthesis
gan01100  Metabolic pathways
Module
gan_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UMN179_00309
Enzymes [BR:gan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     UMN179_00309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEC16346
UniProt: F4HBI9
Position
complement(315832..316665)
Genome map
AA seq 277 aa AA seqDB search
MKLYSKNQRVLDLSQAQVMGILNVTPDSFSDSGKFFSLDKALYHAEEMLKQGASIIDVGG
ESTRSMAEEVTLQQELDRVIPVVEAIRQRFDCWISVDTSKAEVMKAAADAGMDLINDIRA
LTEENALQTAAELDLPVCLMHMQGQPKTMQANPEYQNVVEEVLAWLLQRAAICEQAGVRK
ENIILDIGFGYGKTLQHNYQLLNHLEQFVATGYPLLIGLSRKSMIGNLLQKDVNHRLVGS
VAGALISVMKGAHIVRVHDVEATVDALKVWQATKAAI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatatagtaaaaatcaacgagtattggatctttcccaagcacaagtgatggga
attcttaatgtaacgccggactctttttctgatagcggcaaatttttttcattggataaa
gcgttatatcacgccgaagagatgctaaaacaaggtgcgagcattattgatgttggtggt
gaatcgacgcgatcaatggcggaagaggtaacgttgcagcaagaattggatcgggtgatt
cctgtggttgaagcgattagacagcgttttgattgttggatttcagtggatacctcaaaa
gcggaagtaatgaaagctgccgcggatgccggaatggacttaattaatgatattcgcgca
ttaacagaagagaatgctttacaaacagcagcagaattggatttgccggtctgcttaatg
catatgcaggggcaaccgaaaacaatgcaagctaaccctgaatatcagaatgtggtggaa
gaggtgctggcgtggctgttacaacgggcagcgatttgtgagcaggcaggtgtgcgaaaa
gaaaatattattttggatatcggcttcggttacggtaaaactttgcagcacaattaccaa
ttattgaatcatttagagcaatttgttgccaccggttatccgttattaatcggtttgtca
cgaaaatcgatgatcggtaatttgttgcagaaagatgtcaatcatcgcttagtcggtagt
gttgccggtgcgttgatttcagtaatgaaaggagcgcatattgtcagagtgcacgatgtc
gaagcgacagttgatgcgttaaaagtatggcaggcgacaaaagcggcaatttaa

DBGET integrated database retrieval system