KEGG   Gallibacterium anatis: UMN179_00354
Entry
UMN179_00354      CDS       T01482                                 

Definition
(GenBank) integrating conjugative element membrane protein, PFL_4697 family
Organism
gan  Gallibacterium anatis
SSDB
Motif
Pfam: DUF4400 Strabismus
Other DBs
NCBI-ProteinID: AEC16391
UniProt: F4HBN4
Position
complement(354047..354745)
AA seq 232 aa
MAEQQVKEPRRGLLGNLLSLLGRTFGVLVVSLFVSIVIEWIGMIWFWPELGAQHSKQMML
DEVQYFSVHFTQSILHADPVVLATYVMDTVHQYVFVKSGLLAWLNSVQDPSSPGYALIIY
IRGYIEAVIYITMTFIIRLLILFFTSPLFILVAVVGFTDGLVRRDLRRFGYGYESSFMYH
HAKKAIFPLLIGSWMLYLSLPFSIYPNLLLIPAAFLVGTAISIASASFKKYL
NT seq 699 nt   +upstreamnt  +downstreamnt
atggctgaacaacaggtaaaagaacctagaagagggttgttaggtaatctattatcgttg
cttggtagaacctttggtgtgttagtcgtgtcattatttgtcagtattgtgattgaatgg
atcggtatgatctggttttggccggaacttggtgctcagcatagtaaacaaatgatgttg
gatgaagtgcagtatttttctgtgcattttacacaaagtattctgcacgctgatccggta
gtgttagcaacctatgtaatggataccgtacatcaatatgtatttgtgaaaagtggattg
ttagcgtggttaaatagtgtacaagacccaagcagtccaggatatgcattaattatttat
attcgcggttatattgaagcggttatatatatcacaatgacgtttattattcggttactc
atcctgttttttacctcaccattgtttattttggttgccgtggttggtttcacggatggg
cttgtacgtcgggatttaaggcgatttgggtacggttatgaatcaagttttatgtatcat
cacgcgaaaaaagcgatatttccgctgttaatcggctcttggatgttatatctttcgtta
ccgtttagtatatatccaaatttgttgctgattccagcagcatttttagtggggacagca
atttctattgcgtcagcgagtttcaaaaaatatctttaa

DBGET integrated database retrieval system