KEGG   Gallibacterium anatis: UMN179_00355
Entry
UMN179_00355      CDS       T01482                                 
Name
(GenBank) type IV secretion-system coupling protein DNA-binding domain protein
Organism
gan  Gallibacterium anatis
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf AAA_22
Other DBs
NCBI-ProteinID: AEC16392
UniProt: F4HBN5
Position
complement(354738..356966)
AA seq 742 aa
MSNNHVIESVLRPAVELNTAIVSASAGALCLYAPWSLALSPDIGYGMCGAFWLFSVVRFR
QGWRILKFRRNIRRLPYYALTSKQIPVSQRYLFLGRGFAWEQKHTQRLYTCTRSEVEDYV
KPSLAYQYARTLEKWSDERLPKLAKLLRTDKWYNPVRPLPPVGGSPVIHGIELDEQDVML
PLGERVGHTIVLGTTRVGKTRLAEMLVTQDIHRGKTVDEREVVVFFDPKGDADMLKRMYV
EAKRAGRENEFYVFHLGWPEISARYNAVGRFGRVSEVAGRISGQLSSEGNSAAFKEFAWR
FVNIIARAQVELGRRPDYPSIARYVQNIDELFIDYATHFLGKTQPKAWEAIAAAASKIND
KNTPRNMMGRDPIVIALEQFLTQSKIHDPVLDGLRSAVRYDKTYFDKIVASLLPLLEKLT
TGKIAELLAPDYSDIHDERPIFDWQEIIRKRGIVYIGLDALSDTTVASAVGNSMFADLVS
MAGHIYKYGINQGLPDALQGKSKKVSINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYT
QTLSDIEARTGNRAKAGQVIGNFNNLIMLRVREPATAELLTNQLHEVDVLKNTTISGVTD
SSDPYSNQHFTSNTQDRVSSEKMPMITPANVISLPKGQAFALLEGGKLWKIRMPLPVSDK
NEHIPESIAQLSEYMKENYQTGETLWSQVAYEYTPSNEAIAAFEQLVSTPIISSNTATVP
AESDVDNVDVEKHNTEEGVNNG
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgagtaataaccacgttattgaatccgttttacggcctgctgttgagctgaatacagcg
attgtatcagccagtgcaggcgcattgtgcctctatgccccctggagtctagcacttagt
ccggatattggatacggaatgtgtggtgcgttttggctattttccgtagtgcgttttaga
caaggttggcgtattttgaagtttcgccggaatattcgtagattgccttattacgcacta
accagtaaacagattcctgttagccagcgttatctgtttttgggtagaggatttgcttgg
gaacagaaacatacacaaagactctatacctgtactcgttcagaagtagaagattacgtc
aagccaagtttagcttatcaatacgctcgaacgcttgaaaaatggagtgatgaaagatta
cctaaattagcaaaattattgcgtactgataagtggtataacccagttagaccgttgccg
cccgttggagggagtccggtaattcacggcattgaattggatgaacaggatgtgatgttg
cctttgggtgagcgtgttggacatacgattgtattggggacaacgcgtgtaggtaagacg
cgattagctgagatgttagtaacgcaagatattcatcggggtaagactgttgatgaacga
gaggtggtagtgtttttcgatccgaaaggcgatgcggatatgctgaaacgaatgtatgtg
gaagcgaaacgagcagggcgtgaaaatgaattttacgtatttcatttaggctggccggaa
atatctgctcgatataacgcagtgggacgatttggacgagtatctgaagttgcaggacgt
atttccgggcagttaagttcggaggggaatagcgcagcatttaaggagttcgcgtggcga
tttgtcaatattattgccagagcgcaagtggagcttggtcgccgtccggactatccgtca
attgcgcgttatgtgcaaaatattgatgagctattcattgattatgctacgcattttttg
gggaaaacgcagccgaaagcgtgggaagcgattgctgcagcagcaagcaaaatcaatgat
aaaaatacacctcgcaatatgatgggacgagatcctatcgtgattgcccttgagcaattt
ctgactcaatcaaaaatacacgatccggttttagatggtctgcgtagtgcggtacggtac
gataaaacttattttgataaaatcgttgcttcacttctaccgctacttgagaaattaaca
accgggaaaattgctgagttgcttgcaccggattatagcgatattcacgatgaacgtcct
attttcgactggcaagagattatacgcaaacgaggcattgtttatattgggttagatgcg
ttatctgatactacggttgctagtgcggtaggcaatagtatgttcgccgatctggtttcg
atggcaggacatatctataaatatggtattaatcaagggttgccggatgcgttacaaggt
aagtcgaaaaaggtctctattaacttacattgcgatgaattcaacgagctaatgggtgat
gagtttattccattgatcaacaaagggggtggagccggaattcaagtaacagcatacact
cagaccttgtcggatattgaggcaagaacaggcaatagagccaaggcaggacaagttatt
ggtaactttaataacttaattatgttgcgtgtgcgtgagcctgcaacagcggagttgctt
actaatcagttgcacgaagtggatgtgttgaaaaatacaacgatttcaggggtgacggat
agtagtgatccttatagtaatcaacatttcacatcaaatacgcaagaccgtgtcagttcg
gaaaaaatgccaatgatcacgcctgctaatgtgatcagcttaccgaagggacaagcattt
gcgctgcttgagggaggtaagttgtggaaaattagaatgccattgccggtttctgataaa
aatgagcatattccggaatctatcgcacaattaagtgagtatatgaaagaaaattaccaa
actggagaaactttatggtctcaagtcgcctatgaatatacgccttcaaatgaagcgatt
gccgcgtttgaacagcttgtcagcacgccaattatttcatcaaatactgctactgtgcct
gctgaaagtgatgtagataatgtagatgtagagaagcacaatacagaagagggagtaaat
aatggctga

DBGET integrated database retrieval system