KEGG   Gallibacterium anatis: UMN179_00679Help
Entry
UMN179_00679      CDS       T01482                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gan  Gallibacterium anatis
Pathway
gan00010  Glycolysis / Gluconeogenesis
gan00051  Fructose and mannose metabolism
gan00562  Inositol phosphate metabolism
gan01100  Metabolic pathways
gan01110  Biosynthesis of secondary metabolites
gan01120  Microbial metabolism in diverse environments
gan01130  Biosynthesis of antibiotics
gan01200  Carbon metabolism
gan01230  Biosynthesis of amino acids
Module
gan_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gan_M00002  Glycolysis, core module involving three-carbon compounds
gan_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_00679
   00051 Fructose and mannose metabolism
    UMN179_00679
   00562 Inositol phosphate metabolism
    UMN179_00679
Enzymes [BR:gan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UMN179_00679
Exosome [BR:gan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UMN179_00679
  Exosomal proteins of bladder cancer cells
   UMN179_00679
  Exosomal proteins of melanoma cells
   UMN179_00679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEC16711
UniProt: F4HDQ3
Position
complement(729508..730275)
Genome map
AA seq 255 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELINGLKAELAGVEGCDVAIAPPVMYLAEAEAALAGSKI
ALGSQNVDLKQSGAFTGDISATMLKDFGAKYIIIGHSERRAYHHESDEFIAQKFAVLKEQ
GLVPVLCIGESEAENEAGKTEEVCARQIDAVLNTLGAEAFLGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRSHIAKKDAKVAEQVILQYGGSVNDGNAAELFAMPDIDGALVGGASLKA
PAFATIVKAAAKAKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggcaactggaaattaaacggtagcaaggcatttacc
aaagaattgatcaatggtttgaaagctgaattagcaggtgttgaaggttgtgatgtggca
attgctccgccggtaatgtatttagcagaagcggaagctgcattagccggtagcaaaatt
gcattaggctcacaaaatgttgatcttaaacagtccggcgcgtttaccggtgatatttct
gcaacaatgttaaaagatttcggtgcaaaatatatcattatcggtcactctgaacgtcgc
gcatatcaccacgaaagcgatgaatttattgcacaaaaatttgcagtattaaaagaacaa
ggtttagtgccggtgctttgtattggtgaaagtgaagcggaaaatgaagcaggaaaaaca
gaagaagtttgtgcaagacaaatcgatgccgtgttaaataccttaggtgcagaagccttt
ttaggtgcagttattgcttatgaaccgatttgggcaatcggtacaggaaaatctgctact
ccggcacaagctcaagcggtgcacgctttcattcgtagccatattgcgaagaaagatgca
aaagttgccgaacaagtgattttacaatacggcggttctgttaatgacggcaatgcggca
gaattatttgcaatgccggatatcgatggcgcattagttggcggtgcttcattaaaagca
ccggcgtttgctaccatcgttaaagcagcggcaaaagcaaaaaattaa

DBGET integrated database retrieval system