KEGG   Gallibacterium anatis: UMN179_01974Help
Entry
UMN179_01974      CDS       T01482                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
gan  Gallibacterium anatis
Pathway
gan00620  Pyruvate metabolism
gan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UMN179_01974
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gan02000]
    UMN179_01974
Enzymes [BR:gan01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     UMN179_01974
Transporters [BR:gan02000]
 Other transporters
  Primary active transporters [TC:3]
   UMN179_01974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AEC17987
UniProt: F4HE26
Position
complement(2133807..2135636)
Genome map
AA seq 609 aa AA seqDB search
MTVQAKKIAITDVVLRDAHQSLFATRLRLKDMLPIAAELDEIGYWSLEAWGGATFDACIR
FLGEDPWVRLRELKKAMPKTPLQMLLRGQNILGYRHYADDVVDRFVERAVANGMSVFRVF
DAMNDPRNMKQALTAVRKNGGHAQGTLSYTTSPVHTLETWLDTTEQLLEIGIDSLVIKDM
SGILTPMAAYELVSAIKKRFDVRLHLHCHSTTGMAEMAQLKAIEAGVDGIDTSISSMSGT
YGHPATESMVATLQNTPYDTGLDLHKIEKIAAYFREVRKKYVAFEGQLKGVDSRILVAQV
PGGMLTNLESQLKQQNASDKLDLVLKEIPQVRKDLGYIPLVTPTSQIVGTQSVINVLMGE
RYKNIAKETAGILKGEYGKTPAPVNAELQARVLEGKQPITDRPADHIAPEMDKLIAEVKQ
QAAEKGIKLAKDEIDDVLIVALFPQVGWKFLENRNNPTAFEPEPTGKPVEKAAAKAEVKP
APAESAVYTVELEGKAFVVKVSNGGNIDQIVASQPQTPTPTPAPVVPTAPVAPASSSAQG
EPVNAPMAGSIVKVVVTEGQQVAQDDVLLVLEAMKMETQICAAKAGTVQGIKIKAGDMVA
VGDTLMTLV
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacaagctaaaaaaattgcaattaccgatgtcgttttacgcgatgctcatcaa
tctctattcgctactcgtttacgtttaaaagatatgctgccgattgccgctgaactggat
gaaatcggctactggtctttagaagcgtggggtggcgctacctttgatgcctgtatccgt
tttttaggcgaagatccttgggtacgtttgcgtgaattgaaaaaagcaatgccgaaaaca
cctttgcaaatgcttttacgcggtcaaaatattcttggttatcgtcattatgccgatgat
gtagtcgatcgctttgttgaacgcgccgttgccaacggaatgagcgtattccgcgttttc
gatgcgatgaacgatcctcgtaatatgaaacaggcattgaccgctgtgcgaaaaaatggt
ggtcacgcacaaggtacattgagctacaccaccagtccggttcacactttggaaacctgg
ttggataccaccgaacaactgcttgaaattggtattgattcccttgtaatcaaggatatg
tcgggtattttaacgccaatggcagcttatgaattggtcagtgcaatcaaaaaacggttt
gatgttcgcttgcatttacactgccactcaacaaccggtatggctgaaatggcgcaatta
aaagcaattgaagccggcgttgacggtatcgatacttccatttcttcaatgagcggaact
tatggtcatccggctacagagtcaatggttgccacattacaaaatacgccttacgacacc
gggcttgatctgcataaaattgaaaaaattgcagcttatttccgtgaggttcgtaaaaaa
tatgtcgcttttgaaggtcaattaaaaggcgttgatagccgaattttagtcgcacaggtt
ccaggtggaatgttgaccaacttggaaagtcaattaaaacaacagaatgcctctgataaa
ttggatcttgtcttaaaagaaattccacaagtgcgcaaagatttaggttatattccactg
gtaacgccaacttcacaaattgtcggcactcaatcagtgatcaatgttttaatgggcgaa
cgttataaaaatatcgccaaagaaaccgccggcattctgaaaggcgaatatggcaaaaca
ccggcaccggttaatgccgaacttcaagcccgtgttttagaagggaaacaaccgattacc
gaccgcccggcagaccatattgcaccggaaatggataaattaatcgccgaagtgaaacaa
caagctgccgaaaaaggcattaaactggcaaaagatgaaattgatgatgtgcttattgtt
gcattattccctcaagtcggttggaaattccttgaaaatcgtaataatccgacggcattt
gaacctgaaccaacaggaaaacctgttgaaaaagccgcagctaaagcagaggttaaaccg
gctcctgcagaatctgcggtttataccgttgaacttgaaggcaaagcttttgtagtgaaa
gtcagcaacggcggcaatattgatcaaattgttgccagccaaccgcaaacgcctactcct
acgccggcgcctgttgtgccaacagctcctgttgcaccggcttcatcatccgctcaaggc
gaaccggtaaatgcgccaatggcgggatccattgttaaagtcgttgttacagaaggacaa
caggtagcgcaagatgatgtgttgcttgtacttgaagcgatgaaaatggaaacacaaatc
tgtgctgccaaagccggtaccgtgcaaggcattaaaatcaaagcaggcgatatggtcgcg
gtcggcgatacactaatgacattagtctag

DBGET integrated database retrieval system