KEGG   Gallibacterium anatis: UMN179_02184Help
Entry
UMN179_02184      CDS       T01482                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gan  Gallibacterium anatis
Pathway
gan00010  Glycolysis / Gluconeogenesis
gan00020  Citrate cycle (TCA cycle)
gan00620  Pyruvate metabolism
gan01100  Metabolic pathways
gan01110  Biosynthesis of secondary metabolites
gan01120  Microbial metabolism in diverse environments
gan01130  Biosynthesis of antibiotics
gan01200  Carbon metabolism
Module
gan_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_02184
   00020 Citrate cycle (TCA cycle)
    UMN179_02184
   00620 Pyruvate metabolism
    UMN179_02184
Enzymes [BR:gan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     UMN179_02184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AEC18197
UniProt: F4HFB4
Position
2346849..2348762
Genome map
AA seq 637 aa AA seqDB search
MSKQIAIPDIGGDEVTVTEVMVKVGDTIEVDQSVINVEGDKASMEVPAPEAGVVKEVLVK
VGDKVSTGTPMLVLEAAGAAAPAPAAEAAPAPAAAPAPAAAPAAVASVVDVQVPDIGGDE
VNVTEIMVAVGDTVSEEQSLITVEGDKASMEVPAPFAGVVKEILVKSGDKVSTGSLIMRF
EVAGAAAAAAPAPAAEAAPAAAPAASGGVQDVHVPDIGGDEVNVTEIMVAVGDTVSEEQS
LITVEGDKASMEVPAPFAGVVKEILIKSGDKVSTGSLIMRFEVAGAAPAAAPAQQPAAAP
APQAAAPAPAAAPAASNEDVTKSASFAHATPVVRRLAREFGVNLDKVKGTGRKGRILKED
VQAYVKAAIKAVESGSVSSSAAAGGNAGAGLGLLPWPKVDFSKFGETEEVELGRIKKISG
ANLHRNWVMIPHVTQWDKADITELEKFRKEQNVLAEKQKLDVKITPLVFIMKAVAKALEA
YPNFNSSITEDAQRLILKKYINIGVAVDTPNGLVVPVFKDVNKKGVIELSRELSAMSKKA
RAGKLTASDMQGGCFTISSLGGIGGTHFTPIVNAPEVAILGVSRSEMTPVWNGKEFTPRL
MLPLSLSYDHRVIDGADGARFITYISGVLSDLRRLVM
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattgctattccggatatcggtggtgatgaagttactgtaacagaagtt
atggtgaaagttggtgacactattgaagttgaccaaagtgtgatcaatgttgaaggtgat
aaagcctcaatggaagtaccggcaccggaagcaggtgtggtaaaagaagtattggtaaaa
gtgggtgataaagtttctaccggtactccgatgttggtattggaagcagcgggtgcggca
gcacctgcccctgcagcggaagcagcgccggctccggcagcagcaccggctccggcagca
gcaccggctgcagtggcttctgttgttgatgttcaggttccggatatcggcggcgatgaa
gttaacgttactgaaattatggtcgcagtaggcgatactgttagcgaagaacagtcattg
atcaccgttgaaggtgataaagcttcaatggaagtgcctgcaccgtttgccggtgtggta
aaagaaattttagttaaatcaggtgacaaagtttctaccggttcattgattatgcgcttt
gaagttgccggcgcagcagctgcggcggcacctgctcctgcagcggaagcagctccggcg
gcagcacctgcggctagcggcggtgttcaggatgttcacgttccggatattggcggcgat
gaagtgaatgtgactgaaattatggtcgcagtaggcgatactgttagcgaagaacagtca
ttaattacggttgaaggtgataaagcttcaatggaagtgcctgcgccgtttgccggtgtg
gtaaaagaaattttgatcaaatcaggcgataaagtttctaccggttcattaattatgcgt
tttgaagtggctggcgcagcgcctgcggcagctccagcacaacaacctgcagcggcacct
gctcctcaagcggcagcaccagcgcctgcagcggctccggcagcttctaatgaagatgtg
actaagagcgcaagttttgctcacgcgactccggtagttcgtcgtttagcacgcgaattt
ggtgtgaatcttgataaagtgaaaggtacaggtcgtaaaggtcgtatcttaaaagaagac
gttcaagcttatgtgaaagcggctattaaagcggttgaaagcggttctgtttcttcatca
gctgctgccggcggtaatgccggtgccggtttaggcttgttgccgtggccgaaagttgat
ttcagcaaattcggtgaaactgaagaagttgaattgggtcgcatcaagaagatttccggt
gcgaacttgcaccgtaactgggtaatgatccctcacgtaacacaatgggataaagccgat
attaccgagttagaaaaattcagaaaagagcaaaatgtattagctgaaaaacagaaactt
gatgttaaaattactccgcttgtctttattatgaaagcggtagcaaaagcgttggaagct
tatccaaacttcaatagttcaattactgaagatgcacaacgtctgatcttgaagaaatac
atcaatatcggtgtggcagtagatacaccaaacggcttggttgtaccggtgtttaaagat
gttaataagaaaggtgttattgaactttctcgtgaattgtcagcaatgtcgaagaaagct
cgtgcaggtaaattaacagcttcagatatgcaaggcggatgctttactatctcaagttta
ggcggtatcggtggtactcactttacccctatcgttaatgcaccggaagtggcaatttta
ggggtctctcgttcagagatgacaccggtgtggaatggtaaagaatttacaccacgcttg
atgttgccattgtcattgtcttacgatcaccgtgtgattgatggggcggacggtgcgcgc
tttattacctatattagtggtgtgttgtcggatttacgccgcttagtcatgtag

DBGET integrated database retrieval system