KEGG   Glutamicibacter halophytocola: AOZ07_05455Help
Entry
AOZ07_05455       CDS       T04229                                 

Definition
(GenBank) alanine--glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
gar  Glutamicibacter halophytocola
Pathway
gar00250  Alanine, aspartate and glutamate metabolism
gar00260  Glycine, serine and threonine metabolism
gar00630  Glyoxylate and dicarboxylate metabolism
gar00680  Methane metabolism
gar01100  Metabolic pathways
gar01110  Biosynthesis of secondary metabolites
gar01120  Microbial metabolism in diverse environments
gar01130  Biosynthesis of antibiotics
gar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AOZ07_05455
  09102 Energy metabolism
   00680 Methane metabolism
    AOZ07_05455
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOZ07_05455
   00260 Glycine, serine and threonine metabolism
    AOZ07_05455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gar01007]
    AOZ07_05455
Enzymes [BR:gar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     AOZ07_05455
    2.6.1.45  serine---glyoxylate transaminase
     AOZ07_05455
    2.6.1.51  serine---pyruvate transaminase
     AOZ07_05455
Amino acid related enzymes [BR:gar01007]
 Aminotransferase (transaminase)
  Class V
   AOZ07_05455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALG28494
UniProt: A0A0N9JCW8
Position
1159270..1160367
Genome map
AA seq 365 aa AA seqDB search
MSKTVLQRHLFGPGPCNPYPEATAALGLPLLGHLDPEFIARMDRVGEGLRTLWGTKNVRT
LPLSATGSAGMEAAFVNTINPGDVAVIAINGLFGERMCEVASRVGAEVVRVEHDYGTPID
AQRVADAHPNPAVIAGVHAETSTGVVSDIAALGAIKGDALLITDAVTSIGGMPVLADEWG
IDVGYAGTQKCIGVAPGLAPFTISDRAFERRVQKPQSWYLDLGLLGGYATGATGGGRTYH
HTAPVAMVASLEAGIDRILAEGLDAVTARHQEAGSLLQQGLQEMGLELFAQEGSRLPQLT
TVYVPEAVESAKVRGYLLERFNIEIGGGVGQYASTVWRIGMMGPNANPGSVALLLAALKE
AIAKA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccgttcttcagcgccacctttttggtccgggtccatgcaacccgtacccg
gaagccaccgccgcccttggcctgccgctgctcggccacctcgaccccgaattcattgcc
cgcatggatcgcgtgggcgaggggctgcgcacgctgtggggaacgaagaacgtgcgcacc
ctgcccttgagcgccaccggttcggccggcatggaggcagcttttgtcaacaccatcaac
ccaggtgatgtcgcagtcattgcgatcaacggcctgttcggtgaacgcatgtgcgaagtt
gcctcgcgtgtgggcgccgaggtggtgcgcgttgaacatgactacggcacgccaattgac
gcccagcgcgtggctgacgcccaccccaacccggccgtgattgccggtgtgcacgccgag
acgagcaccggcgtggtttcggatattgccgctctgggcgccatcaagggcgatgccctg
ctgatcaccgacgccgtgacctccatcggcggcatgccggtgctggccgatgagtggggg
atcgatgtgggctacgccggaacccagaaatgcatcggagtggcacctggcctggcaccg
ttcaccatttcggaccgcgcattcgagcgcagggtccagaagccgcagtcctggtacctg
gatttgggcctgctgggcgggtatgccaccggcgccacaggtggcgggcgcacctaccac
cacactgcaccggtggcgatggttgcttcgcttgaagctggcattgaccggattctcgcc
gaaggcctggacgcggtaaccgctcggcatcaggaggcgggcagcctgttgcaacagggc
ctgcaggagatggggctggaactgtttgcccaggaaggcagccgtttgccgcagctgact
accgtttacgtacctgaggcagtggaatcggcgaaggttcgaggctacctgctggagcga
ttcaatattgaaatcggcggtggcgtgggccagtatgccagcaccgtgtggcgcatcggg
atgatgggaccgaacgccaacccgggttcggtagccttgctgctggcggccctgaaagaa
gcgattgccaaggcatag

DBGET integrated database retrieval system