KEGG   Glutamicibacter halophytocola: AOZ07_11060Help
Entry
AOZ07_11060       CDS       T04229                                 

Definition
(GenBank) metal-dependent phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
gar  Glutamicibacter halophytocola
Brite
KEGG Orthology (KO) [BR:gar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOZ07_11060
Enzymes [BR:gar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     AOZ07_11060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ALG29461
UniProt: A0A0N9JAX4
Position
complement(2421898..2422743)
Genome map
AA seq 281 aa AA seqDB search
MRIDLHTHSNVSDGTETPSELIRSAAAAGLDVVALTDHDQTTGWAPAAAAAKEIGLGFIP
GMEITCQDPNGISVHLLSYLHDPNYQPLLDELDLALNARIIRAQRIVERLAEDYPITWDL
VRNHCQPGSTVGRPHIADALVTAGVVENRNEAFANVLSYRSRYYVAHPAVDPSKAVQLVR
EAGGVPVFAHPKASKRGRVVADSTFHDMIDAGLGGVEVHHRDNSEEGKGWLLELAAEHDL
IVTGSSDYHGTGKLNRLGENLTEPEMLQRIIQEGTGSQALM
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgacctgcacacccactccaatgtgtccgacggaacggaaaccccgtccgag
ctgatacgctccgcggctgccgctgggctggatgtggtggcgctgaccgatcatgaccag
accaccggttgggcgccggcggcagcggccgcaaaagaaatcggcctcgggttcatcccc
ggcatggagatcacctgccaggaccccaatggcatcagcgttcacttgctgagctacctc
cacgatcccaactatcaaccgctgcttgacgaactggacctcgcattgaatgcccgcatc
attcgcgcgcagcgcatcgttgaacgcctggccgaggactacccgattacttgggacctg
gtgcgcaaccattgccagcctggctccactgtggggcggccccatatcgccgatgcgctg
gtaacggccggagtcgtggaaaaccgcaatgaggctttcgccaacgtgctttcgtaccgt
tcgcgctactatgtcgcccacccggccgtggacccgtccaaggcggtgcaattggttcgt
gaagcaggtggagttccagtctttgcccatcccaaagcatcaaagcgcggacgtgtcgta
gctgattcgaccttccacgacatgattgatgcgggcctgggcggagtggaagtgcatcac
cgggataacagcgaggaaggcaaaggctggctgctggaactcgccgccgaacacgatttg
atcgtcaccggctcttccgactatcacggaaccggaaaactgaaccggctcggtgagaat
ctcaccgagccggaaatgctgcaacgtattattcaggaaggcaccggatctcaggccttg
atgtag

DBGET integrated database retrieval system