KEGG   Glutamicibacter halophytocola: AOZ07_15160Help
Entry
AOZ07_15160       CDS       T04229                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
gar  Glutamicibacter halophytocola
Pathway
gar02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gar00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOZ07_15160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gar02000]
    AOZ07_15160
Enzymes [BR:gar01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     AOZ07_15160
Transporters [BR:gar02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    AOZ07_15160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 AAA_22 AAA_30 AAA_23 MMR_HSR1 AAA_25 Dynamin_N AAA_27 DLIC FeoB_N
Motif
Other DBs
NCBI-ProteinID: ALG30188
UniProt: A0A0N9J6I3
Position
complement(3285276..3286856)
Genome map
AA seq 526 aa AA seqDB search
MIASEPQQRPNAADIPEYPPTSPVVQMTGITVEFPGVKALDSVDFRLFPGEVHALMGENG
AGKSTLIKALTGVNQIAAGTVMVSGAPARFSGPADAREHGISTVYQEVNLCTNLTVAENI
MLGSEPRRFGGLDWHSMRRQAKVFLTRMGLGIDPASSLGSHSLAVQQLVAISRAMVVNAK
VLILDEPTSSLDTDEVEQLFAVMRQLRQDGVAILFVSHFLDQIYAISDRITVLRNGALVQ
ERLTGELPQRELVSLMIAGTPDAQVGQANERSSSGSRAENAKPLLQAVGLGRKGAVQPFD
LELYPGEVIGMAGLLGSGRTELARLLYGADKADEGSINLQGAPAKLRTPRQALGHKIAYT
SEDRKGEGVVGDLTVAENIILGLQAARGWTRPMPAAKASQVVEAYIKALGIRPANPQALL
KNLSGGNQQKVLLARWLATAPKLLILDEPTRGIDIGAKTEIMNLVSELAEQGMAVVFISA
ELEEVLRLSDRIVVMRDHAKVAEIPSTPDVDVPRLIEIIASGEEDK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatcagaacctcaacagcggccaaacgcagccgatatccccgagtacccacca
acttcaccggtagtccagatgaccggaatcaccgtggaattccccggcgtcaaagcactg
gacagcgttgatttcaggctttttcctggcgaagtccacgccctgatgggagagaacggc
gcgggaaaatccacgctgatcaaggcgctgaccggagtcaaccagattgctgctggcacc
gtcatggtcagcggagccccagcccgtttcagcggtcctgccgacgcgcgggaacatggg
atctccacggtttaccaagaagtcaacctgtgcactaacctgacagtcgctgaaaacatc
atgcttggcagcgaaccacgtcgttttggcggtctggactggcacagcatgcgccgccaa
gccaaagtgttcctcacgcgaatggggctgggcatcgaccctgccagctccttgggatcc
cattccctggcggtccagcagctcgtggcgattagccgcgccatggtagtcaacgccaag
gtcctgatccttgatgagcccacctcatcgttggataccgatgaagtggaacagctattc
gccgtcatgcgccagctgcgccaagatggcgtggcaatcctgttcgtctcgcacttcctg
gaccagatctacgccatttcggaccgcatcacggttttgcgcaacggcgcattggtccaa
gaacggctcaccggcgagctgccgcaacgggagctggtctcgctgatgatcgccggcacc
ccggatgcgcaggtcggccaagccaacgagcgcagctccagcggttcgcgtgccgaaaat
gccaagcccttgctgcaggccgtaggcctgggccgcaagggtgcagtgcaaccgttcgac
ctggaactttatcctggcgaagtcatcggaatggcagggctgctgggttctgggcgaact
gaactggctcgactgctctatggcgcagataaggccgacgaggggtcgatcaatctgcag
ggggcaccagcaaaattgcgtacccctcgccaagcgcttggtcacaagatcgcctacact
tccgaggaccgcaagggcgaaggcgtggtcggcgacctgaccgtggccgagaacatcatc
ctgggactgcaagccgctcgtggctggacccgcccgatgccagcggccaaggcatcacag
gtcgttgaggcctatatcaaggcgcttggaatacgaccggccaacccccaagcgctgctt
aagaacctatcgggtggaaaccagcaaaaagtcctgctggcccgatggctggccactgct
ccgaaactgctgattttggatgaacccacgcgaggcatagatatcggcgcgaaaaccgag
atcatgaaccttgtttcagaactggccgagcaaggcatggcggtggtcttcatttccgct
gagctggaagaggtgctgcgcctctcggatcgcattgtcgtcatgcgcgatcatgcgaag
gttgccgaaatacccagcaccccagacgtggacgtgccacgactcattgaaatcatcgct
tccggggaagaagacaaatga

DBGET integrated database retrieval system