KEGG   Glutamicibacter halophytocola: AOZ07_17765Help
Entry
AOZ07_17765       CDS       T04229                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
gar  Glutamicibacter halophytocola
Pathway
gar00020  Citrate cycle (TCA cycle)
gar00620  Pyruvate metabolism
gar00650  Butanoate metabolism
gar01100  Metabolic pathways
gar01110  Biosynthesis of secondary metabolites
gar01120  Microbial metabolism in diverse environments
gar01130  Biosynthesis of antibiotics
gar01200  Carbon metabolism
Module
gar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOZ07_17765
   00620 Pyruvate metabolism
    AOZ07_17765
   00650 Butanoate metabolism
    AOZ07_17765
Enzymes [BR:gar01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     AOZ07_17765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ALG31013
UniProt: A0A0N9JMG7
Position
complement(3866938..3868413)
Genome map
AA seq 491 aa AA seqDB search
MSAEQAATIIKPGMTVAMSGFTGAGYPKAVPGALAAQMERQHAAGEEFKINVLTGASTAP
ELDGVLAKAEGMNLRLPYMSDPELRRRINEGNMEYMDIHLSHVAQHAWFGFYGKIDVAII
EVVGVTAEGDLIPSSSVGNNKTWLEMADKVIIEVNAQQSAAMEGMHDVYYGTALPPHRKP
IELTTVRDRIGQKYLDVDVSKIAAVVQTDAPDRLSPFAPVDETSEKIADHLLGFLDSEIR
AGRLTEKLLPLQSGVGNIANAVLAGLSRGGYKSLAAYTEVIQDGMLQLIKDGTIEFASAT
SFSLSAEGIEEFNRNVEHYRERILLRAQEISNHPEIIRRLGCIALNGMIEADIYGNVNST
NVLGSHVMNGIGGSGDFARNGYLSVFMSPSTAKGGKISGIVPFASHVDHTEHDTMILITE
QGLADLRGLSPKQRAQQVIENCAHPDYRPLLQDYFDRACRQSYGKHTPHLLGEALSWHQR
FEKTGDMRPAS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaacaggcggcaaccatcatcaagccgggaatgacggtggccatgagcggc
ttcaccggtgccggatacccgaaggcagtgcccggcgccctggccgcccagatggaacgc
cagcacgctgccggcgaggagttcaagatcaacgtgctcaccggcgcctccaccgcccca
gagctcgacggggtgctggccaaggccgagggcatgaacctgcgccttccctacatgtcc
gatcccgagctgcgccgccgcatcaacgagggcaacatggagtacatggacatccacctg
tcccatgtcgcccagcacgcctggttcggcttctacggcaagatcgacgtggccatcatc
gaggtggtcggcgtaaccgccgaaggcgacctgatcccctccagctccgtgggcaacaac
aagacctggctggagatggccgacaaggtcatcatcgaggtcaacgcgcagcaatccgcc
gccatggagggcatgcacgatgtctactacggcaccgccttgcctccgcaccgcaagccc
atcgagttgaccacagtgcgcgaccggatcggccagaagtacctggacgtcgacgtcagc
aagatcgccgcggtggtccaaaccgacgcgccagaccggctgagccccttcgccccggtg
gacgagaccagcgagaagatcgccgatcacctgctgggcttcctggactcggagatccgc
gccggccggctgaccgagaagctgctgccgctgcagtcgggcgtcggcaacatcgccaac
gccgtgctggcgggcctgtcccgcggcggctacaagtccttggccgcctacacggaggtc
atccaggatggcatgctccagctgatcaaggacggcaccatcgagttcgcctcggccacc
agcttctcgctgtctgccgagggcatcgaggaattcaaccgcaatgtcgagcactaccgc
gagcgcatcctgctgcgcgcccaggagatctccaaccaccccgagatcatccggcggctg
ggctgcatcgccctgaacgggatgatcgaggccgacatctacggcaacgtgaactccacc
aacgtcctgggctcccatgtcatgaatggcatcggcgggtccggcgacttcgcccgcaac
ggctacctgtcggtgttcatgtccccgtccaccgccaagggcggcaagatctcgggcatc
gtgcccttcgcatcgcatgtggaccacaccgagcacgacaccatgatcctgattaccgag
cagggcctggccgacctgcgcggcctgtcgcccaagcagcgcgcccagcaggtcatcgag
aactgcgcgcatccggactaccgtccgttgctgcaggactacttcgaccgggcctgcagg
caaagctacggcaagcacaccccgcacctgctgggcgaggccctgtcctggcaccagcgc
ttcgagaagaccggggatatgcgcccggccagctag

DBGET integrated database retrieval system