KEGG   Gemmatimonas aurantiaca: GAU_0480Help
Entry
GAU_0480          CDS       T00878                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00020  Citrate cycle (TCA cycle)
gau00310  Lysine degradation
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01200  Carbon metabolism
Module
gau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GAU_0480 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    GAU_0480 (sucB)
Enzymes [BR:gau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GAU_0480 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PHA_synth_III_E
Motif
Other DBs
NCBI-ProteinID: BAH37522
NITE: GAU_0480
UniProt: C1A5L2
Position
complement(550559..551788)
Genome map
AA seq 409 aa AA seqDB search
MSSIKVPPLGESIVEATVSRWLKKEGDAVAVGDTLVELETDKITVEVPALEAGVLTARAK
GEGDVVAVGEVLGEIAAGAAAASAPVASAPAAAPAPVASAPAAAPVVAAAPSADAKVSPA
AARLATESGVNTADVAGTGRGGVVSKADVVDALRTPQPAAAAAPAPAAAPAKAPTSAAGR
ETREKMTTRRKRIAENLLMSQQSTAHLTTFNEVDMTAITAFRERMKERVEKEQGVKLSFM
PFFAKAACIALKSYPLVNAQIDGDSIVYKHYVNMGIAVASDAGLVVPNVKDADSKSVVEI
GKDIGAVAKRARDGKLSMDDLTGGTFTITNGGVFGSLVSTPIINYPQSGILGLHKIQDRP
IAVDGKVEIRPMMYIALSYDHRIIDGQQAVLFLVRVKELMEDPAAMLVL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatcaaggttccccctctcggcgaatccatcgtcgaggcgaccgtctcgcgc
tggctcaagaaggaaggcgacgctgttgccgtcggcgatacgctggttgagctcgaaacg
gacaagatcacggtggaagtgcctgcgctcgaagcgggcgtgctgacggcgcgcgccaaa
ggcgaaggtgatgtcgtcgccgtcggcgaagtgctcggcgaaattgcagccggcgcggcc
gccgcgagtgcgcctgttgcgagtgcgcctgcagcggcgcctgcgccggtggcatcggcc
cctgcggccgctcccgtcgtcgctgccgcgccttcggcggacgccaaggtctccccggcc
gcagcccgtctcgccaccgaaagtggcgtgaacacggccgatgtggccggcacgggtcgt
ggtggcgtggtctccaaggccgatgtggtcgacgcgttgcgcaccccgcagcctgccgcc
gcggcggcaccggcacccgccgccgccccggccaaggcaccgacctccgcggccggccgc
gagacgcgcgagaagatgacgacgcgccgcaagcgcatcgccgaaaacctgctgatgtca
cagcagtccacggcacatctgacgacgttcaacgaagtcgacatgacggcgatcacggcg
ttccgtgagcgcatgaaggaacgcgtggagaaggaacagggcgtgaagctgtcgttcatg
ccgttcttcgcgaaggctgcctgcatcgcgctcaagtcgtatccgctggtgaatgcgcag
atcgacggcgactcgatcgtctacaagcactacgtcaacatgggcattgccgtcgccagc
gacgcgggcctcgtggtgccgaacgtcaaggacgccgacagcaagagcgtcgtggaaatc
ggcaaggacatcggcgcggtggccaagcgtgcccgcgacggcaagctgtcgatggacgat
ctcacgggtggcacgttcaccatcacgaatggtggcgtgttcggttcactcgtgtccaca
ccgatcatcaactatccacagtcgggcattctgggtctgcacaagatccaggaccgcccc
atcgcagtggatggcaaggtcgagatccgtccgatgatgtacatcgccctgagctacgat
caccgcatcatcgacggccagcaggccgtgttgttcctggtgcgcgtgaaggagctcatg
gaagatccggccgcgatgctggtgctctga

DBGET integrated database retrieval system