KEGG   Gemmatimonas aurantiaca: GAU_1677Help
Entry
GAU_1677          CDS       T00878                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00010  Glycolysis / Gluconeogenesis
gau00051  Fructose and mannose metabolism
gau00562  Inositol phosphate metabolism
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01200  Carbon metabolism
gau01230  Biosynthesis of amino acids
Module
gau_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_1677 (tpiA)
   00051 Fructose and mannose metabolism
    GAU_1677 (tpiA)
   00562 Inositol phosphate metabolism
    GAU_1677 (tpiA)
Enzymes [BR:gau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GAU_1677 (tpiA)
Exosome [BR:gau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GAU_1677 (tpiA)
  Exosomal proteins of bladder cancer cells
   GAU_1677 (tpiA)
  Exosomal proteins of melanoma cells
   GAU_1677 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAH38719
NITE: GAU_1677
UniProt: C1A909
Position
complement(1996975..1997730)
Genome map
AA seq 251 aa AA seqDB search
MHLKPVIAANWKLNHGPTDAKAFLQRFLAQVPKLNDRTVIFFPSAITLTTVTEGLRDRPE
IWVGVQNVHAEAQGAFTGENSVLMARDAGARVVLVGHSERRHVFGESDETTTKKMALIAQ
ARLTAMLCVGETLAEREAGHTADVVERQLAAGLKELDDQQIGAIMLAYEPVWAIGTGRTA
TPEDAAEIHGVLRRALASRVGDKVATGIPILYGGSVNRGNASQLLAASDVDGLLVGGASL
DADGWAGIVRA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcaagccggttattgcggccaactggaagctcaatcacggtccgacggacgcg
aaggcattcctgcagcggtttctcgcgcaggtgcccaagctcaacgaccgcacggtgatc
ttcttcccgtctgccatcacgctcaccacggtcacggaaggtctgcgcgaccgcccggag
atctgggtgggtgtgcagaacgtgcacgctgaagcgcagggtgcgttcacgggagaaaac
tcggtgctcatggcacgcgacgccggcgcccgggtggtgctcgtggggcactctgagcgt
cgccatgtgtttggtgaaagcgacgagacgaccacgaagaagatggcgctcatcgcccag
gcccggctcaccgccatgctgtgcgtcggggaaacgttggccgagcgcgaagccggacac
acggcggacgtcgtggagcggcagctcgccgctggcctcaaggagctcgacgaccagcag
attggcgccatcatgctggcctacgaaccggtgtgggccatcggaacgggccgtacggcc
acgccggaagacgcggccgagattcacggggtgctgcgccgggcgctggcatcgcgcgtg
ggcgacaaggtggcgactggcatcccgatcctgtatggcggctcggtgaaccgcgggaat
gcgtcgcagttgctggccgcgtcggatgtggacggcctgctggtcgggggcgcgtcgctg
gacgccgacggctgggcggggatcgtacgggcgtaa

DBGET integrated database retrieval system