KEGG   Gemmatimonas aurantiaca: GAU_1993Help
Entry
GAU_1993          CDS       T00878                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00020  Citrate cycle (TCA cycle)
gau00310  Lysine degradation
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01200  Carbon metabolism
Module
gau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GAU_1993
  Amino acid metabolism
   00310 Lysine degradation
    GAU_1993
Enzymes [BR:gau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GAU_1993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: BAH39035
NITE: GAU_1993
UniProt: C1A958
Position
complement(2323395..2324717)
Genome map
AA seq 440 aa AA seqDB search
MARVDVIMPQMGESIAEGTVSRWLKKVGDSVKRDEPIFEISTDKVDAEIPSPSAGVLMEI
LVGDGLTVAVNTVVARLETDAAAAAAAPAPSAPAPAAVVAAPAAAPVAATSAPAPAAPKA
PAAPSGSFEERVRTKSSPLVRKIAAEQGVEIGALTGSGIAGRVTRKDLDAYLTSRPAGSA
APAAAPVSVSHAPSDSHGPAATPWAGDIVEPMSKIRKLTSEHMSLARRVAAHVTTLWEVD
LTRVARVRAAVRKDFEAQSGQKLTYLPFILQAVCQQLKRHPMINTAVSGENLIYRKQINL
GIAVALEPTGLIVPVLKHADELSLTGLTRGVNDLAGRARSKKLSPTDVQDATFTISNPGT
FGSLTGTPIIPVGTTAILCLGAIEKRPKVITGADGEDTIAIRTCAYFSLSFDHKVIDGAD
ADRFMGDIKKALESVTEAVV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgtgtagacgtaatcatgccgcagatgggcgagtccatcgcggagggcaccgta
tcacgctggctcaagaaggtgggcgacagcgtgaagcgtgatgaaccgatcttcgaaatc
tccaccgacaaggtcgacgcggagattccgtctccgtcggctggtgtgctgatggagatc
ttggttggtgacgggctcaccgtggccgtgaacacggtcgtggcccgcttggagaccgat
gcggccgctgcggcggcggcgcctgctcccagtgccccagctccggcggcggttgtggcc
gcaccggctgcggcgcctgtcgccgccaccagcgcgcccgcgccggcggccccgaaggcg
ccggccgcgccgtccgggtcgttcgaagaacgcgtgcgcaccaagtcgtcgccgctcgtg
cggaaaatcgctgccgaacagggcgtggagatcggcgccttgaccggcagtggtatcgcc
ggccgggtcacccgcaaggatctcgacgcctatctcacgtcgcgtccggctggtagtgcg
gctcccgccgcggcgccggtatcggtgtcgcatgcgccgtccgactcgcatggccctgcg
gccacgccgtgggccggtgacatcgtcgaaccgatgtccaagatccgcaagctcacctcg
gagcacatgtcgctggcccgtcgggtggcggcgcacgtgaccacgctgtgggaagtggat
ctgacgcgtgtggcgcgggtgcgtgctgcggtgcgcaaggacttcgaagcccagtctggc
cagaagctcacctacctgccgttcatcctgcaggcggtctgtcagcagctcaagcgccac
ccgatgatcaacaccgcggtgtcgggcgaaaacctgatctaccgcaagcagatcaacctt
ggcatcgccgttgcactcgagcccacgggcctcatcgtgccagtgctcaagcacgccgat
gaactctcgctgaccggcctcacgcgtggtgtgaacgatctcgccggccgtgcgcgcagc
aagaagctgagcccgaccgacgtgcaggacgccacgttcaccatcagcaaccccggcacg
ttcggctcgctgacgggcacgccgatcattccggttggtaccacggcgatcctctgcctc
ggtgccatcgagaagcgccccaaggtcatcacgggcgcggacggcgaagacacgattgcc
atccgcacctgcgcctatttctcgctatccttcgatcacaaggtcatcgacggcgcggat
gcggatcgtttcatgggcgatatcaagaaggccctcgaatcggtcaccgaagcggtcgtc
tga

DBGET integrated database retrieval system