KEGG   Gemmatimonas aurantiaca: GAU_2154Help
Entry
GAU_2154          CDS       T00878                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00010  Glycolysis / Gluconeogenesis
gau00052  Galactose metabolism
gau00500  Starch and sucrose metabolism
gau00520  Amino sugar and nucleotide sugar metabolism
gau00521  Streptomycin biosynthesis
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_2154 (glk)
   00052 Galactose metabolism
    GAU_2154 (glk)
   00500 Starch and sucrose metabolism
    GAU_2154 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    GAU_2154 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GAU_2154 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GAU_2154 (glk)
Enzymes [BR:gau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GAU_2154 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAH39196
NITE: GAU_2154
UniProt: C1A9L9
Position
2524246..2525241
Genome map
AA seq 331 aa AA seqDB search
MVTQYAVGVDLGGTNIVVAAMTLDGSKLFGLQSAPTLAAEGADAVIARLARMVNETIDAT
MQETGASRDAFIGVGVGAPGTVDRATGRVLKAPNLDWHNRELAHPMSQLTGLPVQIDNDA
NCATYGEWWLGAARGGVNVIGVTIGTGVGGGIIVDRKVYHGSSDAAGEIGHTTIDLNGRR
CGCGNYGCLEAYASGSAIAGRAREALTNDESSMLRTMVDGDLTRITAAVVYEAAGQGDAV
ALEIVRDTARVLGAGLANLLNIFNPDVVVIAGGVTQAGDALFEPLRKEVRRRAFKSVSER
CHIVPGTLPGTAGVVGAVAAFIAQSTGHPPA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccagtacgccgtcggcgtagatctcggcggcaccaacatcgtcgtcgcggcc
atgacgctcgacggctcgaagctgttcggactgcaatcggcgccgacactcgcggccgaa
ggtgcggacgcggtcattgcacgactcgcccgcatggtgaacgaaacgatcgacgccacc
atgcaggaaaccggtgcatcgcgtgatgcgttcatcggcgtgggagtgggtgcaccaggc
acagtggatcgcgccaccgggcgtgtcctcaaggcgcccaatctcgactggcacaatcgc
gaactggcgcaccccatgtcgcagctcacgggcctgcccgtgcagatcgacaacgatgcc
aactgtgccacctatggcgagtggtggctgggcgccgcccgtggtggcgtgaacgtcatc
ggcgtgacgatcggcacgggggtgggcggtggcatcattgtcgaccgcaaggtctatcat
ggatcgagcgacgccgccggcgagatcggacacacgaccatcgacctgaacggccggcgt
tgcggctgcggcaactatggctgcctcgaggcgtacgcgtcgggcagcgccattgccgga
cgcgcgcgcgaagccctcacgaacgacgagtcgtcgatgctccgcacgatggtggatggg
gatctcacgcgcattacggcggcggtggtgtacgaagccgctggccagggcgatgccgtg
gcgttggagatcgtgcgggatactgcacgggtgctgggcgccggcctggccaatctgctc
aacatcttcaaccccgatgtggtggtcatcgccggcggtgttacccaggcgggcgatgcc
ctattcgagccgctgcgcaaggaagtgcgtcgacgggcgttcaagagtgtgtccgagcga
tgccacatcgtcccgggcacgctgcctggcacggccggcgtcgtgggtgccgttgcggca
ttcatcgcccaatccacgggccatccgccggcctga

DBGET integrated database retrieval system