KEGG   Gemmatimonas aurantiaca: GAU_2438Help
Entry
GAU_2438          CDS       T00878                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00130  Ubiquinone and other terpenoid-quinone biosynthesis
gau00627  Aminobenzoate degradation
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    GAU_2438
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GAU_2438
Enzymes [BR:gau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     GAU_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Herpes_UL56
Motif
Other DBs
NCBI-ProteinID: BAH39480
NITE: GAU_2438
UniProt: C1AB74
Position
complement(2858043..2858681)
Genome map
AA seq 212 aa AA seqDB search
MSSDLDRWMPRHPVVLAITGASGAPYAVRLLQALVALRVPTWLIVSGHGWRLLQTESEIG
DLETLRVQVESGGTPGSFASVVTVFDDTDRGAPPASGSARTSGMVVCPCSMGTVSAIAHG
TSRSLVERAADVALKERRKLILVPRETPLSLIHLENLTAVTRAGATVIPAAPGFYHKPAG
ISDLVDFMVARILDHLDIEHDVGRRWGSIPGE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgacctggatcgctggatgccgcgccatcccgttgtcctcgccattaccggc
gcctctggggcgccctatgccgtgcggctgttgcaggcattggtcgcgttgcgggtaccc
acctggctgatcgtgtcggggcatgggtggcgcctgctgcagacggaaagtgagatcggc
gacctcgagaccttgcgggtgcaggtggaatcgggcggcacgccgggcagctttgccagc
gtggtcacggtgttcgatgacacggatcgtggcgccccgccggccagtgggtcggcgcgc
accagcggcatggtggtgtgcccgtgctccatgggcacggtgagcgccatcgcccacggc
acgtcacgttcgctggtggagcgggcggccgatgttgccctcaaggagcggcggaagctc
atcctggtgccccgggagacgccgctgtcgctgatccatctggagaacctcacagcggtc
acccgtgcgggggcgacggtgattccggcggctccggggttctaccacaaacccgccggg
atttccgacctggtggacttcatggtcgcgcgtatcctcgatcatctcgatatcgaacac
gacgtgggacgtcgctggggctcgattcccggggagtga

DBGET integrated database retrieval system