KEGG   Gemmatimonas aurantiaca: GAU_2499Help
Entry
GAU_2499          CDS       T00878                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00260  Glycine, serine and threonine metabolism
gau00630  Glyoxylate and dicarboxylate metabolism
gau00670  One carbon pool by folate
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01130  Biosynthesis of antibiotics
gau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GAU_2499 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GAU_2499 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    GAU_2499 (gcvT)
Enzymes [BR:gau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     GAU_2499 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: BAH39541
NITE: GAU_2499
UniProt: C1ABD5
Position
complement(2928677..2929801)
Genome map
AA seq 374 aa AA seqDB search
MTANDTGAQGSALKRTPLHDVHVALGAKIVPFAGYEMPVQYPAGITVEHKAVRESCGMFD
VSHMGEVIVRGPDAIRFVSSVTSNDVAALGIGQVQYSTLLRADGTIVDDLLVYRFADHLM
LVINASNRDKDLAHLQAHLAGFDCTMEDISDATALLAVQGPQAPAIVAALADVPLDGVKY
YWFTEGRVAGVPCIISRTGYTGELGFELYFDATHATAVWNAVMAAGAVTPCGLGARDTLR
LEAGLCLYGNELDDQITPLEAGLNWLVKLGKAEPFLGKDVLVRQHQDGTDRKLVGFTFEE
RAIPRHGYPVVYGGVAFGEVRSGTMSPTLGIPVGTCYLPSAAAVEGTRFDVDIRGKRVPA
RVVKLPFYKRPGKA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaacgataccggcgcgcaaggctcagcgctcaagcgcacgccgctgcacgat
gtccacgtcgcgcttggcgcgaagattgtcccctttgcgggctatgagatgccggtgcag
tacccggccggcatcaccgtcgaacacaaagccgtacgcgagtcgtgcggcatgttcgat
gtgtcccacatgggcgaagtcatcgtgcgtggccccgacgccattcggttcgtgtcgtcc
gtgaccagcaacgatgtcgcagcactcgggatcgggcaggtgcagtacagcaccctgctg
cgggccgacggcaccatcgtcgatgacctgctggtgtatcggtttgccgatcacctcatg
ctcgtcatcaacgccagcaatcgcgacaaggacctcgcgcatctgcaggcacacctggcc
ggattcgattgcacgatggaggacatctccgatgcgacggcgttgctcgcggtgcagggc
ccgcaggcacccgccattgtcgctgcgctcgccgacgtgccgctcgatggcgtcaagtac
tactggttcacggaagggcgcgtcgctggcgtgccgtgtatcatctcgcgcaccggctac
acgggcgagttgggcttcgagctgtatttcgatgcgacacacgcgacggcggtgtggaac
gccgtgatggcggccggcgcagtgacgccgtgtggacttggggcccgcgacacgctgcgg
ctcgaggccggtctgtgcctgtacggcaatgaactcgacgatcagatcacgccgctcgaa
gcaggcctcaactggctggtgaagctgggcaaggccgaaccgttcctcggcaaggatgtg
ctcgtgcgccagcatcaggacggcaccgatcgcaagctcgtaggcttcaccttcgaagag
cgcgccattccgcggcacgggtatcccgtggtctacgggggcgtcgcgtttggggaagta
cgcagcgggaccatgagtccgacgctcggcattcccgtgggaacgtgttatctgcccagc
gcggccgccgtcgagggcacacgcttcgacgtggacattcgcggcaagcgggtgccggca
cgggtggtgaagctgccgttttacaagcgcccggggaaggcgtga

DBGET integrated database retrieval system