KEGG   Gemmatimonas aurantiaca: GAU_2501Help
Entry
GAU_2501          CDS       T00878                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00220  Arginine biosynthesis
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01130  Biosynthesis of antibiotics
gau01230  Biosynthesis of amino acids
Module
gau_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    GAU_2501 (argF)
Enzymes [BR:gau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     GAU_2501 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: BAH39543
NITE: GAU_2501
UniProt: C1ABD7
Position
complement(2930395..2931306)
Genome map
AA seq 303 aa AA seqDB search
MHRDFLNIADFSSDETFALLDLAERMRTGAYQAKPLTGKALAMIFMKSSTRTRMSFEVGA
NQLGGTAHFLSPRDVQIGRGEPIADTARVLSRYVQGIMIRTFAHQDVVELAEYASVPIIN
GLTDLSHPCQILADVLTMQQHLGGVRGKTVAWIGDGNNMANSWMEAAAHLGFTLRLACPE
GYDPDAQFLADAKARGGDVQLLRDPREAVAGADVVTTDVWASMGQEEEQSKRAVAFALYQ
VDAELMARAAAHAVFLHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKAIMAVLMGG
ERL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgacttcctgaacatcgctgatttctcgtccgacgaaacgttcgcgctgctc
gatctggccgaacgcatgcgaacgggcgcctaccaggccaagccgctgactggcaaggcc
ctggcgatgatcttcatgaagtcgtcgacacgtacgcgcatgtcgttcgaagtgggtgcg
aaccagttgggcggcaccgcgcattttctctccccgcgcgatgtccagatcggccgtggt
gaacccattgccgacacggcccgggtgctgtcgcgatatgtgcagggcatcatgatccgc
acgtttgcccatcaggacgtggtggaactggccgagtatgcctcggtgccgatcatcaat
ggactgaccgacctgtcgcatccgtgtcagatcctcgccgatgtgctcaccatgcagcag
cacctcggcggcgtgcggggcaagacggtggcgtggattggcgatggcaacaacatggcc
aactcgtggatggaagcggctgcccatctcgggttcacgctgcgtctggcctgccccgaa
ggctacgatcccgacgcgcagttccttgccgacgccaaagcccgtggtggcgatgtccag
ctactgcgtgatccgcgggaagccgtggcgggcgccgacgtcgtgaccaccgatgtgtgg
gcctcgatggggcaggaggaggagcagtcgaagcgtgcggtggcttttgccctgtaccag
gtcgacgccgagttgatggcccgtgcggcggcgcacgccgtcttcctgcactgtttgcca
gcgcatcgtggtgaggaagtgaccgccgaggtgatagacgggccccagagcgtcgtatgg
gatgaagccgagaatcgtctgcacgtgcagaaggcgatcatggcggtgctcatgggcggc
gagcgtctgtga

DBGET integrated database retrieval system