KEGG   Gemmatimonas aurantiaca: GAU_2508Help
Entry
GAU_2508          CDS       T00878                                 

Gene name
gid
Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification enzyme Gid
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
gau  Gemmatimonas aurantiaca
Brite
KEGG Orthology (KO) [BR:gau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gau03016]
    GAU_2508 (gid)
   03036 Chromosome and associated proteins [BR:gau03036]
    GAU_2508 (gid)
Enzymes [BR:gau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     GAU_2508 (gid)
Transfer RNA biogenesis [BR:gau03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    GAU_2508 (gid)
Chromosome and associated proteins [BR:gau03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    GAU_2508 (gid)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA NAD_binding_8 DAO FAD_binding_2 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C Pyr_redox FAD_binding_3 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: BAH39550
NITE: GAU_2508
UniProt: C1ABE4
Position
complement(2938823..2940208)
Genome map
AA seq 461 aa AA seqDB search
MSDIPTTASRDTTAPVHIVGGGLAGSEAAWQLAERGHEVILHEMRPVRGTAAHRTERLGE
LVCSNTFKSTETSNAHGLLKAEMRALGSLILSCADEARVPGGSALTVDRDIFSQGVHDRV
HAHPRITVSREEVTELPAVGIIATGPLTSDALAERIRARLGVESLAFYDAIAPVVAVESI
DQSIAFRASRWGKETMEGAGEEGAFLNCAFTKDEYDAFIAALTTADQFTAHEFDAVPYFE
GCMPVEEMARRGAESLRFGPMKPIGLQDPRSDKRPWAVVQLRMEDRGGRMWNLVGFQTRL
RIPEQARVFRMIPGLAEAEFLRYGSIHRNSYVNAPAALSPHLALRDAPTTLFAGQITGVE
GYTESSATGMLAGINLSRMLRGQEPVIPPAVSMLGALYRYLREADPKHFQPMNANFGLLD
ELEGVPPKVLKDKVRKRELFAERALQALHTWRDEHGLAVTR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacattccgacgaccgcgtcacgggataccacagctccagtccacattgtcggc
ggcggtcttgccggcagcgaagcggcctggcagctcgctgagcgtgggcacgaggtgatt
ctgcatgagatgcgtcccgtgcgtggcacggcggcgcatcgcaccgaacgcctcggtgag
ttggtgtgctcgaacaccttcaagagtaccgaaacgtccaacgcgcatggcttgctcaag
gcggaaatgcgcgcgctgggttcactcatactctcttgcgccgacgaagcgcgtgtgcca
ggtggcagcgcgctgaccgtcgatcgtgacatcttttcgcagggtgtgcacgatcgggtg
catgcgcatccgcgtatcaccgtgtcgcgagaggaagtcaccgagttgccagcggtgggc
atcatcgccaccgggccactgaccagcgacgcattggccgaacgcattcgggcgcgactc
ggtgtggagtcgttggcgttttatgatgccatcgcacccgtcgtggccgtggagtccatc
gatcagtccattgccttccgcgcgtcgcgttggggcaaggaaacgatggaaggggcgggg
gaagaaggcgcatttctcaactgtgctttcacgaaggacgagtacgatgcgttcatcgct
gcgctgaccaccgccgatcagttcacggcgcacgagttcgacgcggtgccatacttcgaa
ggctgcatgcccgtcgaagagatggcacgccgtggggcggagtcgctgcgtttcggtccc
atgaagcccatcgggttgcaggatccgcgctccgacaagcgcccgtgggcggtggtgcag
ttgcgtatggaagaccgcggggggcgcatgtggaacctggtcgggttccagacgcgcctg
cgtattccggaacaggcgcgggtgtttcgcatgattcctggactcgccgaagcggagttt
ctgcgctacggcagcattcaccggaattcgtacgtgaacgcaccggcggcactgtcaccg
cacttggcattgcgtgatgcacccaccacgctttttgccgggcagatcacgggcgtcgag
gggtataccgaaagcagcgccacgggcatgctggccggcatcaacctgtcccgcatgctg
cgtgggcaggagccggtgatccctcccgcggtgtccatgctcggggcgctgtatcgctat
ctgcgcgaggccgatcccaagcacttccaaccgatgaacgccaacttcggtttgctcgac
gagctggaaggcgtgccacccaaggtgctgaaggacaaggtgcgcaagcgcgaactgttc
gccgaacgtgccctgcaggcgctgcatacgtggcgcgatgaacacggactcgccgtcacc
cgctga

DBGET integrated database retrieval system