KEGG   Gemmatimonas aurantiaca: GAU_2729Help
Entry
GAU_2729          CDS       T00878                                 

Definition
(GenBank) putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00790  Folate biosynthesis
gau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GAU_2729
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gau04147]
    GAU_2729
Enzymes [BR:gau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     GAU_2729
Exosome [BR:gau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GAU_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a PlyB_C
Motif
Other DBs
NCBI-ProteinID: BAH39771
NITE: GAU_2729
UniProt: C1AAH3
Position
complement(3208114..3208413)
Genome map
AA seq 99 aa AA seqDB search
MSASAPSALSDIEIQRALGALPGWSRKGDAICKSYHFATFPAGIAFLAKVADVAERLQHH
PDIDVRYTRVQFVLSTHDAGGVTQKDFELAHQIETLASA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttccgccccctcggcgctctccgacatcgagattcagcgggcccttggggcc
ttgcccggctggtctcgcaaaggcgacgccatctgcaagagctaccacttcgccaccttc
cctgcggggatcgcgttcctcgccaaggtcgcggacgtggctgagcggctccagcaccat
cccgatatcgatgtgcgatacacccgtgtgcagttcgtgctcagcacacacgatgcgggt
ggcgttacgcagaaggatttcgaactggcacaccagatcgaaaccctggcttctgcgtga

DBGET integrated database retrieval system