KEGG   Gemmatimonas aurantiaca: GAU_3865
Entry
GAU_3865          CDS       T00878                                 

Definition
(GenBank) hypothetical membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:gau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GAU_3865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gau02044]
    GAU_3865
Secretion system [BR:gau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GAU_3865
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C
Other DBs
NCBI-ProteinID: BAH40907
NITE: GAU_3865
UniProt: C1AEI0
Position
complement(4553482..4557009)
AA seq 1175 aa
MASRKPIIRWIIAAAVLLLFLVILLVLERTMALDPVALWVLRVGLVLLGLIAAGAILWFL
RPQDQEPVLDQGDDVLLAIGAARARLPRGSFASRALVLLLGPEGSAKTTLVARSGGDPQL
LAGDAPAGANDVPPSTKTANVWAMQNAVVAELASGLLSDAPRFAKVVRALRAPRVAAAVG
QGDAAPRAAVVCVPADLFYAGGNGEQLQQLAQSMRQRLAEAARELGLALPVYVMFTKMDR
VPHFEPWVSVFTKDELRAPLGATLPFDATSNTGNYAERLAPRLDVAFSEIAQSVGSRRVD
LLGRETQIDRRYASYELPRELQKLQTAATQFLVELCRPTQLGTSPQLRGFYFTGARPVVV
TDVGVAAAAAAPQAAAGATGVFRRPEMPTAAAAAAPVSRRVPEWVFLDRFLRDVVLTDTG
AASVARGGVSVQRTRRVLLGTAIAATVLLLLGVTASWLGNRSLQGRVSSAASAVAALPVV
QAAPGTIAFPSAEALTRLDALRAQLDTLQAYEQDGPPLRMRFGLWRGTALLDAARPVWFD
GFRKQLFADAWGALNDSLKALPDIPTAANDYGVSYGWLKGYLITTTTPDSSTSEFLTPVL
LTSWQRGMATDADITALARRQFEYYAGVLPKTNPYPRAADAAVVSHARDFLSRFTGAEQI
YLNMIGAANKQAPPVAIPQAPGLLTATAEVQGAFSTKGASFMSDAFRNADRYFQGETWVV
GDATASQSVNRDSVVTALRGRYADDYVRTWRQVVQSATVVRPATVKDAADKLDKLAGVQS
PLLQVLRTVAVNTAIDSAMRQAFQPVHAVTPPEITDKFVSEKNQPYMDGLLGLQGALLQV
SNMPPAVDTPSTQALVMAAQMAAGDVTKARVSAKRVSQGFDVSNVGGALASPVEQLLLAP
ITGAEAVLKTAASQRPPARRIAAAPAAPAAPAGGGGGAPNNAPEIAALNERGRAICTRID
QLTSRFPFNPDATADASVADVKAILAPGTGELWVFQQERLAPYLEKSGNTWALKPGGKIE
LSKSFVDFFNRAAEVSGALFAEDPTTPMVRWLASGVITPNTPLLTLKNNGKEARFDQRSF
KNEVVWPATNGREAELLAQFKKNKPVTVRKANGDWAIFRLVSAADAFEGQSVTWNATGKD
AEPVMVKFEALRREASSVLTRGWLGRMSCVSQVTK
NT seq 3528 nt   +upstreamnt  +downstreamnt
atggcgtctcgcaagcctatcatccggtggatcatcgccgccgcggtattgttgttgttc
ctcgtcatcctcctcgtgctcgagcgcacgatggccctggatcccgtggcgctgtgggtg
ctgcgggtggggctggtgctgctcggcctgattgcggctggcgccattctctggttcctg
cggccgcaggatcaggaacccgtgctcgatcagggcgacgatgtgctgctggcgatcggt
gccgcccgcgcccgtctgccccgtggcagctttgcttcgcgtgcgttggtgctgctcctg
gggcccgagggcagcgcgaagaccacgttggtggcgcggtcgggcggcgatccgcagttg
ctggcgggtgatgcaccggctggcgcgaacgatgtgccgccgtcgaccaagaccgccaat
gtgtgggcgatgcagaacgcggtggtggccgaactggcgagtgggctgctctccgacgcc
ccgcgctttgccaaagtggtgcgtgccctgcgcgcgccgcgtgtggccgcggccgtgggg
cagggtgacgcggcgccgcgtgccgctgtggtgtgtgtcccggccgatctgttttatgct
ggcggcaacggcgagcagttgcagcagctcgcgcagtccatgcgtcagcgtttggccgaa
gcggcgcgcgaactgggactcgccctgccggtgtacgtgatgttcacgaagatggatcgt
gtgccgcacttcgagccgtgggtgagtgtgttcacgaaggacgagttgcgcgcgccgctg
ggcgcgacgctgcccttcgatgccacgtcgaacaccggcaactatgccgaacgcctcgct
ccgcgactggacgtggcgttttcggagattgcgcagtcggtgggatcacgtcgcgtggac
ctgctgggacgcgagacgcagatcgatcgacgttatgcgtcctatgaattgccgcgcgaa
ctgcagaagctgcaaacggccgcaacgcagttcctggtggagttgtgccggccgacgcag
ttgggcacgagcccgcagttgcgcggcttctacttcacgggcgcgcgtccggtggtggtg
acggatgtcggggtggctgcggctgccgcagcaccgcaggccgccgccggtgcaacgggt
gttttccgtcgccccgaaatgccgacggcggccgccgcggcggcgccggtttcgcgacgg
gtgccggagtgggtgttcctcgatcgtttcctgcgtgacgtggtgctcaccgataccggt
gcggcatcggtggcgcgtggtggcgtgagtgtgcagcgcacgcgacgtgtgttgctgggc
acggcgattgccgcgacggtgttgttgctgctgggcgtgacggcgtcatggttgggcaac
cgttcgctgcagggtcgggtatccagcgcagccagtgccgtggcggccttgccggtggtg
caggcggcgccgggcacgatcgcgtttccgagcgccgaagcgctcacccgtctcgatgca
ctgcgcgcgcagctcgacaccctgcaggcgtacgaacaggatggtccgccgctgcgcatg
cggtttggcctgtggcgtggtacggcgctgctggatgcggcgcggcccgtgtggttcgac
ggcttccgcaagcagctcttcgccgatgcctggggcgcactcaatgattcgctcaaggcc
ctgccggacattcccacggcggcgaacgactacggcgtgtcgtacggttggctcaagggt
tacctgatcacgaccaccacgccggacagcagcacgtcggagttcctcacgccggtgctg
ctcacgagctggcagcggggcatggccactgacgccgacatcacggcgctcgcccgtcgg
cagttcgagtactacgccggtgtgctgccgaagaccaatccgtatccacgcgccgccgac
gcggctgtggtgagtcatgcgcgggatttcctgtcgcgcttcactggtgcggagcagatc
tatctgaacatgatcggcgccgccaacaagcaggcgccaccagtggccattccccaggcg
ccgggtttgctgacggcgacggcggaagtgcagggtgctttcagcacgaagggggcgtcg
ttcatgagcgatgccttccgcaatgccgatcgctacttccagggtgagacctgggtggtg
ggtgatgccaccgcgtcgcagtcggtgaaccgcgattcggtggtgacggcactgcgcggc
cggtatgccgacgactacgtgcgcacctggcgtcaggtggtgcagagcgccacggtggtg
cgtccggccacggtgaaggacgccgccgacaaactcgacaagctggccggtgtgcagtcg
cccttgttgcaggtgttgcgcacggtggcggtgaacacggcgatcgattcagcgatgcgg
caggcgttccagcccgtgcacgcggtcacgccgccggagatcaccgacaagttcgtctcc
gaaaagaatcagccctacatggacggcttgctcggcttgcagggggcgctgttgcaggtg
tcgaacatgccgccggccgtggacacgcccagcacgcaggcactggtgatggcggcgcag
atggccgctggtgatgtcacgaaggcgcgtgtgtccgccaagcgggtgtcgcagggcttc
gatgtgagcaatgtgggtggcgcgctcgcgtcgccggtggagcagctcttgctggcaccg
atcacgggcgcggaagcggtgctcaagaccgccgcctcacagcggccgccggcacgtcgc
atcgcagcggcgcctgcggcacccgccgctccggctggcggcggtggtggtgctcccaac
aacgctccagaaatcgcggcgctcaatgaacgtggacgcgcgatttgtacacgtatcgat
cagctcacgtcgcgcttcccgttcaacccggatgcgacggctgatgcaagcgtggcggac
gtgaaggcgattctggcgcccggcactggtgagttgtgggtgttccagcaggagcgtctc
gcgccgtatctcgagaagtccggcaacacgtgggcgctgaagccgggtggcaagatcgaa
ttgtcgaagagcttcgtcgacttcttcaatcgcgccgccgaagtgtcgggcgccttgttt
gccgaagatcccaccacgcccatggtgcgctggctggcgagtggtgtgatcacacccaac
acgccgctgctcacgctcaagaacaacggcaaggaagcgcgcttcgatcagcgctcgttc
aagaacgaagtggtgtggccggccaccaacggccgtgaagccgaactgctcgcacagttc
aagaagaacaagccggtcacggtgcgaaaggcgaacggtgactgggccatcttccgtctg
gtgtcggctgccgatgcctttgaaggtcagagcgtgacgtggaacgccacgggcaaggac
gcggaaccggtgatggtgaagttcgaagcgctgcgccgtgaagcgtcgtcggtgctgacg
cgcggctggctgggtcgtatgagctgcgtttcgcaggtcacgaagtaa

DBGET integrated database retrieval system