KEGG   Gordonia alkanivorans: C5O27_12680Help
Entry
C5O27_12680       CDS       T05876                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
gav  Gordonia alkanivorans
Pathway
gav00780  Biotin metabolism
gav01100  Metabolic pathways
Module
gav_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C5O27_12680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gav01007]
    C5O27_12680
Enzymes [BR:gav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     C5O27_12680
Amino acid related enzymes [BR:gav01007]
 Aminotransferase (transaminase)
  Class II
   C5O27_12680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AZZ81822
UniProt: A0A3T0V0D2
Position
2799884..2801068
Genome map
AA seq 394 aa AA seqDB search
MTITSGQPVAGQDVTSGEVGLAWLARAARDRAEAGLHREPHVRRAGADAVNLGSNDYLGL
STHPDVIAGAQAAAAQWGGGSTASRLVVGTTAAHVDLENELADFLGFPAALTFSSGYLAN
VGAVTALAGRGDLIVSDTGSHASLIDGCRLSRARVVVVDRGDHEAVRAALAARTEERALV
VTDSVYSIDGEPAPVADLYAAARAHGAVLLVDEAHAVGVRGPGGRGLVAEQGLSGAPDLV
VTTVLSKSFGAQGGVVLGPEILRSHLIDCARPFIFDTGLNPAAVGAARAALRVLRAYPAL
PDRLRDNARHLARACGVDEPAAAVISIIVGDPQRAVDAAAACRDRGVLVGCFRPPSVPPG
TSRLRITVRADLDAATLDHVAEVVDAALREVGAR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcacctcgggacagccggtggccggccaggatgtcacctcgggtgaggtcgga
ctcgcctggctcgcccgtgccgcacgtgatcgtgccgaggccggcctgcatcgcgagccg
catgtccgacgagccggtgccgacgccgtcaatctcggctcgaacgactacctcggactg
tcgacgcaccccgacgtcatcgccggtgcgcaggccgcggccgcgcagtggggtggcggg
tcgacggcgtcgaggctcgtcgtcggcaccaccgcggcccatgtcgacctcgagaacgaa
ctggccgatttccttggttttcctgcagcactaaccttttcgtctggctatctcgccaac
gtcggtgcggtgaccgcactcgccggacgcggcgatttgattgtcagtgacaccgggtcg
catgcgtcgctgatcgacgggtgccgcctgtctcgggcacgcgtggtggtcgtcgaccgc
ggcgatcacgaggcagtacgggccgcgcttgccgcgcgcaccgaggaacgtgctctcgtg
gtcaccgactcggtgtacagcatcgacggtgagccggccccggtcgccgacctgtacgcc
gcggcccgcgcgcacggtgcggtgctgctcgtcgatgaggcccacgccgtcggcgttcgc
ggtcccggtggacgcgggctcgttgccgaacagggactttccggtgcgccggatctggtg
gtcaccacggtcttgtccaagtccttcggggcgcagggtggggtggtcctcggaccggag
atcctccggtcgcacctgatcgactgcgcgcgcccgttcatcttcgacaccggactgaat
ccggcggcggtcggcgcggctcgtgccgcactacgagtactgcgggcctaccccgcgctg
ccggaccggttgcgggacaacgctcgccacctggcgcgcgcttgcggcgtcgacgagcct
gccgccgccgtcatctcgatcatcgtcggcgatccgcagcgagccgtcgacgcggccgcg
gcctgccgtgatcgcggagtcctagtcgggtgcttccgcccgccgtcggtcccgccgggc
acatcccgcctgcggatcaccgtccgcgccgacctcgacgccgcgactctcgaccacgtc
gccgaggtcgtcgacgccgcgctacgtgaggtgggtgcccgatga

DBGET integrated database retrieval system