KEGG   Gordonia alkanivorans: C5O27_15775Help
Entry
C5O27_15775       CDS       T05876                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
gav  Gordonia alkanivorans
Pathway
gav00020  Citrate cycle (TCA cycle)
gav00620  Pyruvate metabolism
gav00650  Butanoate metabolism
gav01100  Metabolic pathways
gav01110  Biosynthesis of secondary metabolites
gav01120  Microbial metabolism in diverse environments
gav01130  Biosynthesis of antibiotics
gav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C5O27_15775
   00620 Pyruvate metabolism
    C5O27_15775
   00650 Butanoate metabolism
    C5O27_15775
Enzymes [BR:gav01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     C5O27_15775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AZZ82344
UniProt: A0A3T0V1M8
Position
3470288..3471802
Genome map
AA seq 504 aa AA seqDB search
MPSGRIRNTAFASKVMSADDAVKYIQPDDTVAISGFASAGTPKVVIPALADKIKNTRANG
SNFTINLLTGASVSTETERLLTEVDGIALRMPYQSESTARKRINDGRMDYVDIHLSHVAQ
QVWVGYYGQVDVAVVEVSGITESGELIPAASIGNNKTWLDVAKKVILEVNSWIPEAVEGM
HDVYYGTALPPHRKPIPLTRVQDRIGQPTFRVDPAKVVAVVETNQRDSASPVTPPDAISE
AIAGHVLEFFDYEVRNGRLPADTLLPLQAGIGNVANAVLGGLDRGPYKGLTCYSEVIQDS
MLRLIKDGTVAHASSTALALSEAGIEELTANVDFYRNHITLRPQEISNHPEVVRRLGVIA
MNGMLEADIYGNVNSTHVMGTKIMNGIGGSGDFARNGYVSLFMSPSTAKDGAISSIVPMT
PHVDHTEHDCQVLVTEQGLADLRGLSPRRRARLVIEKCAHPEFRPMLNDYFARAEAMPAA
GQTPHILDEAFSFHQRFLDTGSMR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgccatcgggacgtattcgcaacaccgcgttcgcgtcgaaggtgatgtccgccgacgac
gccgtgaagtacatacagccggacgacaccgtggcgatcagcggttttgccagtgccgga
accccgaaggtcgtcatcccggccctcgccgacaagatcaagaacacccgggcgaacggc
tcgaacttcacgatcaacctgttgacgggcgcctcggtctcgaccgaaaccgaacgtctc
ctcaccgaggtcgacggcatcgcgctgcgcatgccgtaccagtcggagagcaccgcccgc
aagcggatcaacgacggccggatggactacgtcgacatccacctgtcccacgtggcgcag
caggtctgggtgggctactacggccaggtcgacgtcgccgtcgtcgaggtttccggaatc
accgaatcgggggagctgattccggccgcgtccatcggcaacaacaagacctggctcgac
gtcgcgaagaaggtgatcctcgaggtcaactcgtggattcccgaggccgtcgagggcatg
cacgacgtctactacggcaccgcactgccgccgcaccgcaagccgatcccgctgacccgg
gtgcaggatcgaatcgggcagccgacgttccgggtcgacccggccaaggtcgtcgcggtc
gtggagaccaaccaacgcgacagcgccagcccggtgaccccgcccgacgcgatcagtgag
gcgatcgccggtcacgtcctcgagttcttcgactacgaggtccgcaacggtcggctgccc
gccgacacactgctgcctctgcaggccggcatcggcaacgtcgccaacgccgtcctcggc
ggtctggaccgcggcccttacaaaggtctgacctgctactcggaggtcatccaggacagc
atgttgcggctgatcaaggacgggaccgtcgcacacgcgtcgtcgaccgctctggcactc
agcgaggccggcatcgaggagctgacggccaacgtcgacttctaccggaaccacatcacc
ctgcgtccgcaggagatcagcaaccatcccgaggtcgttcgtcgtctcggcgtgatcgcg
atgaacggcatgctcgaggccgacatctacggcaacgtgaactcgacgcacgtgatgggc
accaagatcatgaacggcatcggcggttcgggcgatttcgcgcgcaacggctacgtgtcg
ctgttcatgagcccgtccacggcgaaggacggtgcgatctcgtcgatcgtcccgatgacg
ccgcacgtcgaccacaccgaacacgactgccaggtgctggtcaccgaacagggactggcg
gacctgcgtgggctgtcaccccgacgccgtgcccggctggtcatcgagaagtgtgcgcac
ccggagttccggccgatgctgaacgactacttcgcccgcgccgaggcgatgcccgcggcc
ggccagaccccgcacatcctcgacgaggcgttcagcttccaccagcggttcctggacacc
ggctcgatgcgctga

DBGET integrated database retrieval system