KEGG   Gordonia alkanivorans: C5O27_20370Help
Entry
C5O27_20370       CDS       T05876                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gav  Gordonia alkanivorans
Pathway
gav00450  Selenocompound metabolism
gav00970  Aminoacyl-tRNA biosynthesis
gav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C5O27_20370
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C5O27_20370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gav01007]
    C5O27_20370
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gav03016]
    C5O27_20370
Enzymes [BR:gav01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C5O27_20370
Amino acid related enzymes [BR:gav01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C5O27_20370
Transfer RNA biogenesis [BR:gav03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C5O27_20370
 Prokaryotic type
   Other AARSs
    C5O27_20370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f SEA
Motif
Other DBs
NCBI-ProteinID: AZZ83122
UniProt: A0A3T0V443
Position
4473240..4474832
Genome map
AA seq 530 aa AA seqDB search
MAPDLTSPDLSGPAEDGTSYGAGRPYYLTTAIAYPNGAPHIGHAYEYISADALARFKRLD
GFDVRFLTGTDVHGQKMQQTAQAEGIPTAELANRNSDRFQSLQERLGSSFDRFIRTSDED
HKRASEELWKRMSDRGDIYLDKYSGWYDVRDETFYAEADTEIKNDAGERVASDTGHVVTW
TEEETYFFRLSAYQDKLLELYEAQPDFIGPDVRRNEVISFVKGGLTDLSVSRTTFDWGVP
VPDHPEHVMYVWVDALTNYLTGVGFPDDAVTFERFWPADLHIIGKDIIRFHCVYWPAFLM
SAGVELPKRVFAHGFLFNKGEKMSKSVGNVVDPENLIDEFGLDPVRYFFLREVSYGQDGS
YSAEAIVSRINADLSNEFGNLAQRTLSMIGKYFDGVVPAVADLTDTDKALLDRADSLLGT
VREHFDNQAIHLGLEALWSTLAETNRYISAQEPWKLAKTDLDRTGTVLYVCAEVVRIVAV
LSQPVMPESSNKILDLLAVGDDRQFSAVATRLAAGTALPKPSPVFPRYEN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcacccgatctgaccagccctgatctgtccggcccggccgaggacggcacctcgtac
ggcgcggggcggccgtactacctcaccaccgcgatcgcgtatcccaacggcgcaccgcac
atcgggcacgcctacgagtacatctccgccgatgctctcgcacggttcaagcgactcgac
ggattcgacgtccggttcctgaccggcacggacgtccacgggcagaagatgcagcagacc
gcgcaggccgagggcatccccaccgccgagctcgccaaccggaactccgaccgcttccag
tcgttgcaggaacgcctgggctcgagcttcgaccgtttcatccgtacctccgacgaggac
cacaagagggcgtcggaggaactgtggaagcggatgagcgaccgcggtgacatctacctc
gacaagtactccggctggtacgacgtgcgcgacgagaccttctacgccgaggccgacacc
gagatcaaaaacgacgccggcgagcgcgtcgcctccgacaccggacacgtggtgacctgg
accgaggaggagacctacttcttccggctctcggcctaccaggacaagctcctcgagctg
tacgaggcgcagcccgacttcatcggtcccgacgtccgccgcaacgaggtcatcagcttc
gtcaagggcgggctgaccgacctgtcggtgtcgcgcacgacgttcgactggggtgtcccg
gtccccgaccatcccgagcacgtcatgtacgtgtgggtggacgcgctgaccaactacctc
accggtgtcggcttccccgacgacgcggtgaccttcgagcgtttctggcccgccgacctg
cacatcatcggcaaggacatcatccggttccactgcgtgtactggccggcgttcctgatg
agcgcgggcgtcgaactgcccaagcgggtgttcgcgcacggcttcctgttcaacaagggt
gagaagatgtccaagtcggtcggcaacgtcgtcgacccggagaacctcatcgacgagttc
ggcctcgacccggtgcgctacttcttcctgcgcgaggtgtcctacggccaggacggctcg
tactccgccgaggcgatcgtgtcgcgcatcaacgccgacctgtccaacgagttcggcaac
ctcgcccagcgcaccctgtcgatgatcggcaagtacttcgacggcgtggtcccagcggtc
gccgatctgaccgacaccgacaaggccctgctggaccgggccgactcgctgctcggcacc
gtccgcgagcacttcgacaaccaggccatccacctcgggctcgaggcactgtggtcgacg
ctggcagagaccaaccggtacatctccgcgcaggagccgtggaagctcgcgaagaccgac
ctcgaccgcaccggcaccgtgctctacgtgtgcgccgaggtcgtgcgcatcgtcgcggtg
ctgagtcagccggtgatgccggagtcgtccaacaagatcctcgacctgctcgcggtcggc
gacgaccgtcagttcagcgccgtcgccacccgcctggcggcgggaaccgcgctgccgaag
ccgtcacccgtgttcccgcgttacgagaactga

DBGET integrated database retrieval system