KEGG   Gemmatirosa kalamazoonesis: J421_2297Help
Entry
J421_2297         CDS       T03025                                 

Definition
(GenBank) type III restriction protein res subunit
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
gba  Gemmatirosa kalamazoonesis
Brite
KEGG Orthology (KO) [BR:gba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:gba02048]
    J421_2297
Enzymes [BR:gba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     J421_2297
Prokaryotic defense system [BR:gba02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   J421_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EcoEI_R_C ResIII SWI2_SNF2 DEAD Helicase_C HSDR_N
Motif
Other DBs
NCBI-ProteinID: AHG89834
UniProt: W0RFH1
Position
2662461..2665427
Genome map
AA seq 988 aa AA seqDB search
MPLEAAAREEIDRALVASGWLVQDLAAMNLYAGPGVAVREVPLAPGHGVADYLLYADCQA
VGVVEAKRVGETLTGVEIQSEKYGAGLPAGIPAPVRPLPFLYQSTGVETRFTNRLDPVPR
SREVFAFHRPETLAAWATAEPLWLPLAGGAPDPRSERPATLRARLTAMPGVEPGGLWPAQ
LDTVRHLEASLAAGRPRALVQMATGSGKTIAAVASIYRLLKFGGAKRVLFLVDRANLGRQ
ALKEFQSYRTPDDGRLFTELYNVQRLTANRVDPVANVVIGTVQRLYSMLRGEPTMAEEAD
ELDADTALDAVALTGDAGTGGGLAALRRDPIPVAYNPDLPVELFDVVFVDECHRSIYTLW
RQVVEYWDAFLVGLTATPSKLTYGFFDANVVQEYGHEHAVADGVNVDFDVYRIRTEITER
GSAVEAGQIVDRRDRETRRRRWEQLDEPLVYDAAALDRDVVAPDQIRTVVRAFRDRFLPE
VFPERTHVPKTLVFAKDDSHADDLVKILRDELSLGNDAVQKITYKTGTARIVERVPGPDG
AEVERVTYKSSGVRPEDLLQSFRNSYHPRIAVTVDMIATGTDVKPLEVLWFMRTVRSRTL
FEQMKGRGVRVVSPDDLRAVTPDAAAKTRYVIVDCVGVCEEPMADTRPMDVQPTVSLERL
LQAVAMGNVDPEVASTLASRLVRLDARLGRDERASVAATTGGPTLRDLAHGIVDALDPDR
QRAAAREAAAAAPGARVAEPGWEPGEAAVARARAALLRAALAPLAGDPQLRERLLDLKRA
KEQTIDTASADTLLGAGLSPEARDRALGLTTSFEAFLTEHRDELSALRLLYGSRGPGQAR
LTRAAVEELRRALLDRQPPLALDAVWRAYETLDRSRVRGGPARLLTDVVALVRFATHRDD
ALAPLPSVARARLDTWLARMEAGGRRFTDEQRVWLAMMVDHVAADVEIEAEDFDDPPFTQ
RGGLAGAHRVFGTELPRVLEEIGEVIAA
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgcccctggaagccgccgcccgcgaggagatcgaccgcgcgctcgtggcgtccggctgg
ctggtgcaggacctcgcggccatgaacctctacgccggccccggcgtggccgtccgggag
gtcccgctcgccccgggacacggcgtcgccgactacctgctctacgccgactgccaggcg
gtgggcgtggtcgaggccaagcgggtgggggagactctcaccggcgtggagatccagagc
gagaagtacggcgccggcctcccggccggcatcccggcgcccgtgcgcccgctcccgttc
ctgtaccagtcgacgggcgtcgagacccggttcacgaaccggctcgaccccgtgccgagg
agccgcgaggtcttcgcgttccaccgccccgagactctcgcggcgtgggccaccgcagag
ccgctgtggctccctctcgccggcggggcgcctgacccgcgctcggagcggccggccacc
ctacgggcccgcctcacggccatgcccggggtggagcccggcggcctctggccggcgcag
ctcgacaccgtgcggcacctcgaagcctcgctcgccgccggccgcccccgcgcgctggtc
cagatggccacgggctcggggaagaccatcgccgccgtggccagcatctaccggctgctc
aagttcggcggcgcgaagcgcgtgctcttcctcgtcgaccgcgcgaacctcggccggcag
gcgctcaaggagttccagagctaccgcacccctgacgacggccggctcttcactgagctc
tacaacgtgcagcgcctcacggccaaccgggtggacccggtggccaacgtggtgatcggc
acggtgcagcgcctctactcgatgctccgtggggagcccacgatggccgaggaggccgac
gagctggacgccgacaccgcgctcgacgccgtcgcgctgaccggcgacgccgggacgggc
ggcgggctcgccgcgctccgccgcgaccccattcccgtcgcctacaaccccgacctcccc
gtcgagctgttcgacgtcgtgttcgtcgacgagtgccaccggagcatctacacgctctgg
cgacaggtcgtcgaatactgggacgcgttcctcgtcggcctcactgcgacgccgtcgaag
ctcacctatggcttcttcgacgccaacgtggtgcaggagtacgggcacgagcacgcggtg
gccgacggcgtcaacgtcgacttcgacgtgtaccgcatccgcaccgagatcaccgagcgc
ggctcggcggtggaggccgggcagatcgtcgaccggcgcgaccgggagacacgccgccgt
cggtgggagcagctcgacgagccgctcgtctacgacgccgcggcgctcgaccgcgacgtc
gtggcgcccgaccagatccggaccgtggtgcgcgccttccgcgaccgcttcctccccgag
gttttccccgagcgcacgcacgtccccaagacgctcgtcttcgccaaggacgactcgcac
gcagacgacctggtgaagatcctccgcgacgagctgtcgctgggcaacgacgcggtgcag
aagatcacctacaagaccggcaccgcgcgcatcgtcgagcgcgtgccggggcccgacgga
gccgaggtcgagcgcgtcacctacaagtcgagcggggttcgtcccgaggacctcctgcag
agcttccgcaactcctaccacccgcgcatcgccgtcacggtcgacatgatcgccaccggc
accgacgtgaagccgctcgaggtgctctggttcatgcgcacggtgcgcagccgcacgctg
ttcgagcagatgaaggggcgcggcgtccgcgtggtctcgcccgacgacctgcgcgcggtg
acccccgacgccgcggccaagacgcgctacgtgatcgtggactgcgtgggcgtctgcgag
gagccgatggccgacacgcgcccgatggacgtgcagcccacggtgtcgctggagcggctg
ctccaggcggtggcgatggggaacgtggacccggaggtcgcctcgacgctcgccagccgc
ctcgtccgcctcgacgcccggctcggccgcgacgagcgggcgagcgtggccgcgaccacg
ggcgggcccacgctccgcgacctggcgcacgggatcgtcgatgcgctcgaccccgaccgg
cagcgcgcggcggcccgcgaggcggcggccgccgcgccgggcgcgcgggtggccgagccg
gggtgggagccgggcgaggccgcagtggcgcgagcccgcgccgcgctgctccgggccgct
ctcgctcccctggccggcgacccgcagctccgcgagcgtctgctcgacctcaagcgcgcg
aaggagcagaccatcgacacggcgagcgccgacaccctcctcggcgccggcctctccccc
gaggcgcgcgaccgggcgctcggcctgaccacgagcttcgaggcgttcctcaccgagcac
cgcgacgagctctcggcgctccgactcctctacggctcgcgcgggcccggacaggcgcgg
ctcacccgggcggcggtcgaggagctgcgccgggcgctgctcgaccggcagccgccgctc
gcgctcgacgccgtgtggcgcgcctacgagacgctcgaccggtcgcgcgtgcgcggcgga
ccggcgcggctgctgaccgacgtcgtggcgctggtgcgcttcgctacgcaccgtgacgac
gcgctggccccgctgccgtcggtggcgcgggcgcggctcgacacgtggctcgcgcgaatg
gaggcgggcgggcgccgcttcaccgacgagcagcgcgtgtggctcgcgatgatggtcgac
catgtggcggcggacgtggagattgaggcggaggacttcgacgacccaccgttcacgcag
cgcggcgggttggcgggggcgcaccgggtgttcgggacggagctgccgcgggtgctagag
gagatcggggaggtgatcgcggcatga

DBGET integrated database retrieval system