KEGG   Gemmatirosa kalamazoonesis: J421_2298Help
Entry
J421_2298         CDS       T03025                                 

Definition
(GenBank) restriction modification system DNA specificity domain-containing protein
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
gba  Gemmatirosa kalamazoonesis
Brite
KEGG Orthology (KO) [BR:gba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:gba02048]
    J421_2298
Enzymes [BR:gba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     J421_2298
Prokaryotic defense system [BR:gba02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   J421_2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S SH3_9
Motif
Other DBs
NCBI-ProteinID: AHG89835
UniProt: W0RHN4
Position
2665424..2666767
Genome map
AA seq 447 aa AA seqDB search
MSFTASLSELVAENRSGLLACAPSWERVRLGDVATVLNGFPFPSSRFTRDTGTPLLRIRD
VARSSTEAYFDGFVDPEFLVQPGELVVGMDGDFSATLWRGPVAALNQRVCKLSPDERWYD
QRLLALVLPGYLDAINGATSSITVKHLSSRTVADIPLPLPPLAEQRRIVAALEEHLSDLD
AAVAGLERARANVRRFADAAIATGTNPRADWPIVPLRELGSLKGGVTKGQKRRAGDVTRA
VPYLRVANVQRGRLDLSDVRTIEATEREIAELRLLPGDVLFNEGGDRDKLGRGWVWNGEL
SECIHQNHVFRARFDGSRVESRFVSHYANSHGQRYFLDQGKQTTNLASISMTKLGELPVP
VPPLDEQRAILSEIEERLGVAERTAADIDVQLARAARLRQAILQRAFSGRLVPQDPTDEP
ASALLARVRAERPAPSAGRRPRASTRA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcactgcttcactctctgagttagtcgccgagaaccgaagcggtctgctcgcg
tgcgcgccctcttgggaacgtgtacgcctgggcgacgtcgcgacggtcctcaacggattt
ccgttcccctcttcgcgtttcaccagagacacgggcacgccgctcctccgaatccgggac
gtggcgcggtcgtctaccgaggcgtacttcgacgggttcgttgacccggagttcctggtc
cagcccggggagcttgtcgtcggcatggacggcgacttcagtgcgacgctgtggcgaggg
ccggtggcggcgctgaaccagcgggtgtgcaagctctcgcccgatgagcggtggtacgac
cagcgtctgctcgcgcttgtccttccgggctacctcgacgcgatcaacggcgcgacgtcg
tcgatcacggtgaagcacctgtcttcccgcacggtcgctgacatcccgctcccgcttcct
ccgctcgccgagcagcgccgcatcgtcgccgcgctcgaggagcacctgtcggacctcgac
gcggcagtggcggggcttgagcgggcgcgggccaacgtgcgtcgcttcgcggacgcggcc
atcgcgacgggcacgaacccgcgggccgactggcctatcgtgcctcttcgcgagctaggc
tcgctcaagggtggcgtcacgaaggggcagaagcggcgtgctggcgacgtcacgcgcgcc
gtgccctacctccgggtcgcgaacgtccagcgcggccgactggatctgagcgacgtgcgc
accatcgaggcgaccgagcgggagatcgcggaactgcggctgctccctggcgacgtgctg
ttcaacgagggtggcgaccgtgacaagctcggacgcggctgggtgtggaacggcgagttg
agcgagtgcatccaccagaaccacgtcttccgggcacgtttcgatgggagtcgcgtggag
tcacggttcgtgtcgcactacgcgaacagccacggacaacgctacttcctcgaccagggg
aagcagaccaccaacctggcctcgatcagcatgacgaagctcggcgagctccccgtcccg
gtgccgccgcttgacgagcagcgggcgatcctctccgagatcgaggagcgtctcggcgtc
gcggagcgcaccgccgccgacatcgacgtccagctcgcccgcgctgcgcgcctgcgccag
gccatcctccagcgcgccttctctggccgcctcgtcccgcaggacccgaccgacgagccg
gcgtctgcgttgctcgcccgcgtccgcgccgagcgcccggcgccttccgcgggccgtcgc
ccccgcgcgtccacgcgcgcctga

DBGET integrated database retrieval system