KEGG   Gemmatirosa kalamazoonesis: J421_3592Help
Entry
J421_3592         CDS       T03025                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
gba  Gemmatirosa kalamazoonesis
Brite
KEGG Orthology (KO) [BR:gba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    J421_3592
Enzymes [BR:gba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     J421_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AHG91129
UniProt: W0RJ54
Position
complement(4143641..4144474)
Genome map
AA seq 277 aa AA seqDB search
MSDGQHVDLHLHSTASDGALAPEAVVDAARAAGLAAIALTDHDTVGGVDAAIRAGQSLGV
RVIAGVELSAHDGAMEVHLLGLHIARVDLMASALARFRDDRVTRAEQIVAKLNAIGVPLT
VDAVLAESGGGAVGRPHVARALVKGGFVADEREAFYRYLATGKKAYVDKPRLEVADAVRL
VHEAGGIVVWAHPGSEGRRERVERFVAAGIDGLEVRHPSHNADDIDRLTALADFFRLVPS
GGSDWHGQPGARAIGMMNVPAEWLAVQERRAESRRAA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacggccagcacgtcgacctgcacctgcactcgacggcctccgacggcgcgctc
gcgcccgaagccgtcgtggacgcggcgcgcgcggcagggctcgcggcgatcgcgctcacc
gaccacgacacggtcggcggcgtcgacgccgcgatccgcgccggccagtcgctcggcgtg
cgcgtcatcgcgggagtcgagctgagtgcgcacgacggggcgatggaggtccacctgctc
ggcctccacatcgcgcgcgtcgatctcatggcgagcgcgctcgcgcggttccgcgacgac
cgcgtcacgcgcgccgagcagatcgtcgcgaagctgaacgcgatcggcgtcccgctcacg
gtggacgccgtgctcgccgagtcgggcggcggcgccgtggggcggccgcacgtcgcgcgc
gcactcgtgaagggcggcttcgtcgccgacgagcgcgaggcgttctaccgctatctcgcg
acgggcaagaaggcgtacgtcgacaagccgcgcctcgaggtcgccgatgccgtgcgcctg
gtccacgaagcggggggcatcgtggtgtgggcgcacccgggcagcgagggacgacgcgag
cgcgtcgagcggttcgtcgccgcgggcatcgatgggctcgaggttcgccacccgagccac
aacgccgacgacatcgatcgactcaccgcgctcgccgacttcttccgcctcgtgccgagc
ggcggctccgactggcacggccagcccggcgcgcgcgcgatcggcatgatgaacgtgccg
gccgagtggctggccgtgcaggagcggcgcgccgagtcgcgccgggctgcctaa

DBGET integrated database retrieval system