KEGG   Granulibacter bethesdensis CGDNIH3: GbCGDNIH3_0069Help
Entry
GbCGDNIH3_0069    CDS       T03155                                 

Definition
(GenBank) Alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
gbc  Granulibacter bethesdensis CGDNIH3
Pathway
gbc00860  Porphyrin and chlorophyll metabolism
gbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GbCGDNIH3_0069
Enzymes [BR:gbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     GbCGDNIH3_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: APG30428
UniProt: A0A1L3GUM7
Position
complement(74947..75522)
Genome map
AA seq 191 aa AA seqDB search
MQLALIRHTRPAIADGLCYGRLDVPLADDREETARTILAQLTDMQDAMIVSSPALRCQWL
ANWLADWMAGHILPAGIMIDPRLQELDFGDWEGSRWDDIDRATLDDWAASPDDFTPPNGE
SIRTLRHRIDQIWAEWMYDRQNRIVVTHGGPLRILCALAAARPVDLSAPAPGFGSVTRVE
EPPGFRTSESD
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagttggccctgatccgccataccagaccagccattgccgacggactctgctatggc
cgccttgatgtcccgctggccgatgatcgggaggagaccgcccgcaccattctggcgcaa
ctgacagacatgcaagatgccatgatcgtcagcagtccggccttgcgctgccagtggctg
gccaactggctggccgactggatggcaggacacatcctgcccgccggaatcatgatcgat
ccaagacttcaggagcttgatttcggcgactgggaaggaagtcgctgggacgatatcgac
cgcgccacactggatgactgggcggcatcacccgatgattttacccctcccaacggggaa
agcatacgcaccctgcgccatcggatcgaccagatctgggcagagtggatgtatgatcgg
caaaaccgaatcgttgtaactcatggcggcccgctgcgcattctctgcgcgctggcagcg
gcgcggccggttgatctctccgcccctgcacccggttttggcagcgtaacccgcgtggag
gagccgccgggattcaggacatcagaaagcgattga

DBGET integrated database retrieval system