KEGG   Granulibacter bethesdensis NIH3.1: GbCGDNIH3_0088Help
Entry
GbCGDNIH3_0088    CDS       T03155                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
gbc  Granulibacter bethesdensis NIH3.1
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GbCGDNIH3_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHJ61827
UniProt: W6HYS7
Position
complement(97248..97841)
Genome map
AA seq 197 aa AA seqDB search
MQRICAPIWHRHWTELRESPLPLWNRPDGATTNPACRHCDQGQAPSFFRYVCKHHTIDDP
LMSDHNAYVCVTRHIRVTVQPIYLADQSRPDGHHFVWAYRVCIANEGSSTVQLLQRTWHI
TNALGHTQHIHGDGVVGEQPVLEPGEEFNYTSGTPLDTPSGFMHGTYHMIETSSGEAFDI
TIPAFSLDSPHQNTKLH
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggatctgtgcgccgatctggcacaggcattggacggagctgcgtgaaagccca
ttgcccctgtggaacaggccggatggtgccaccaccaatccggcctgccgccattgcgat
cagggacaagccccctcattcttcagatatgtctgcaagcaccacacgattgatgatcca
ctcatgagcgatcacaacgcctatgtctgcgtgacccggcacatccgggtgaccgtccag
ccaatctatctggccgatcagtcccgccctgatgggcaccatttcgtatgggcctatcgg
gtctgtatcgccaatgaaggttcttccacggttcagctgctccaacgtacctggcacatc
accaatgcgctgggccatacccaacatattcacggtgacggcgtggtaggggagcagcct
gtgctggaacccggcgaagaattcaactacacgtccggcacaccgctcgatacgccctcc
ggctttatgcacggaacatatcatatgatcgaaacgtcctccggggaggccttcgacatc
accattccggccttcagcctcgacagcccccatcagaacacaaagctgcattga

DBGET integrated database retrieval system