KEGG   Granulibacter bethesdensis CGDNIH3: GbCGDNIH3_0447Help
Entry
GbCGDNIH3_0447    CDS       T03155                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gbc  Granulibacter bethesdensis CGDNIH3
Pathway
gbc00071  Fatty acid degradation
gbc00280  Valine, leucine and isoleucine degradation
gbc00310  Lysine degradation
gbc00362  Benzoate degradation
gbc00380  Tryptophan metabolism
gbc00620  Pyruvate metabolism
gbc00630  Glyoxylate and dicarboxylate metabolism
gbc00640  Propanoate metabolism
gbc00650  Butanoate metabolism
gbc00900  Terpenoid backbone biosynthesis
gbc01100  Metabolic pathways
gbc01110  Biosynthesis of secondary metabolites
gbc01120  Microbial metabolism in diverse environments
gbc01130  Biosynthesis of antibiotics
gbc01200  Carbon metabolism
gbc01212  Fatty acid metabolism
gbc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GbCGDNIH3_0447
   00630 Glyoxylate and dicarboxylate metabolism
    GbCGDNIH3_0447
   00640 Propanoate metabolism
    GbCGDNIH3_0447
   00650 Butanoate metabolism
    GbCGDNIH3_0447
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GbCGDNIH3_0447
   00072 Synthesis and degradation of ketone bodies
    GbCGDNIH3_0447
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GbCGDNIH3_0447
   00310 Lysine degradation
    GbCGDNIH3_0447
   00380 Tryptophan metabolism
    GbCGDNIH3_0447
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GbCGDNIH3_0447
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GbCGDNIH3_0447
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GbCGDNIH3_0447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gbc04147]
    GbCGDNIH3_0447
Enzymes [BR:gbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GbCGDNIH3_0447
Exosome [BR:gbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GbCGDNIH3_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHJ62216
UniProt: W6I251
Position
508415..509596
Genome map
AA seq 393 aa AA seqDB search
MEQPVILSAARTAIGRFGGGLSSVPAHQLGSVAIKAALERCGVAPEDVEEVILGQVLTAG
QGQNPARQAAIAAGIPVGHTAFGVNQVCGSGLRAVMLAAQQVMTGHARLMVAGGQENMSL
APHIAHLRNGTRFGDIQLVDTMIRDGLWDVFNGYHMGITAENVASAHGISRERQDLFALE
SHGRAARAMQAGVFREEIASVFLPGRHGTVEVNADEHIRPDTTLEALAALRPGFSETGTV
TAGNASGINDGAAALVIASAAEASRRGLLPLARIVSFASAGVDPAMMGLGPVPASRKALD
LAGWRVADLDLIEGNEAFAAQACAVNALMGWDTARVNVNGGSIALGHPIGASGARVLVTL
LHEMQRREVRRGLATLCIGGGMGVAMCIERLHS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcccgttatcctgagcgcggcccggaccgccattggccgcttcgggggtggc
ctgtcctctgttcccgcccatcaactggggtcggttgcgatcaaggcggcgctggaacgc
tgtggcgtcgcgccggaggatgtggaggaagtcattctcgggcaggtgctgacggcgggg
caggggcagaatcctgcgcgtcaggcggcgatcgctgccggtattccggttggacatacc
gcctttggtgtcaatcaggtctgtggctccggcttgcgcgcggtgatgctggcagcgcag
caggtcatgactggccatgcccgactgatggtggcgggtggtcaggaaaacatgagtctg
gcccctcacatcgcccatctgcggaacggaacccggttcggtgacattcagcttgtcgat
acgatgatacgggacgggctgtgggatgtgttcaacggctatcacatgggcatcacggcg
gagaacgtagcatcggcccacgggatcagccgtgagaggcaggatctctttgctcttgaa
agtcatggccgggcggcccgggccatgcaggccggtgttttcagggaggaaatcgccagc
gtgttcctgcccggtcgtcacggcacggtagaagtcaacgcagatgaacatatccgccct
gataccacgctggaggccctggcggccttgcggcccggcttttccgaaaccggtaccgtg
acggcaggtaatgccagcggcatcaatgacggcgctgcggcgctggtgattgccagtgcg
gcggaggcgtcccgtcggggactgcttccgctggcgcggattgtctcctttgcctccgcg
ggggtcgatccggccatgatggggctggggccggttccggccagccgtaaggcgcttgat
ctggccggatggcgtgtcgccgatctggatctgattgagggtaacgaagcctttgccgcg
caggcctgtgccgtgaacgccctgatggggtgggataccgcccgggtcaatgtgaatgga
ggctctatcgcgctcgggcatccgatcggggcatccggtgcccgtgtgctggtgacgttg
ctgcatgaaatgcagcgccgggaggttcggcgaggtctcgccacactctgcatcggcggc
ggcatgggtgtggccatgtgcatcgagagactccatagctga

DBGET integrated database retrieval system