KEGG   Granulibacter bethesdensis NIH3.1: GbCGDNIH3_0849Help
Entry
GbCGDNIH3_0849    CDS       T03155                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
gbc  Granulibacter bethesdensis NIH3.1
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gbc03009]
    GbCGDNIH3_0849
Enzymes [BR:gbc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     GbCGDNIH3_0849
Ribosome biogenesis [BR:gbc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    GbCGDNIH3_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AHJ62674
UniProt: W6IGU3
Position
complement(1012192..1013184)
Genome map
AA seq 330 aa AA seqDB search
MPATPNDSSQAEITVFAPSDAAPERIDRFLAIHLPDMSRSRLKSLIESGAVHRDGQSVRG
PAEMVRPGSLYRLRLPTPAPAIPIAQHIAFPILFEDDDLIVLDKPAGMVVHPAPGSPDGT
LVNALLAYCGENLPGIGGEKRPGIVHRLDKDTSGVMVVAKTEFALAALSALFAARDLERL
YTALAWGVLTPREGDIEGAIGRDPRDRKRMAIVRHGGKPALTHYRAMATWYDAVTRMECK
LATGRTHQIRVHLSANGHPIIGDPVYLRRIPAVAKSLDQDVKNALLDFPRQALHAGVLGF
RHPRTGENLRFETPLPEDMMSLIDLLDHNS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaccccgaacgattcaagccaagcagaaataacggtctttgcgccctccgat
gcagcgccggagcggatcgaccgctttctggccatccatctgcccgatatgagccgctcc
cggctgaaatcactgatcgagagcggcgcggtccaccgtgatgggcaaagtgtccgtgga
ccggcagagatggttcgtcccggcagcctgtaccggctgcgtctgcccacacctgctccg
gccattcccattgctcaacacatcgccttcccgatcctgttcgaggatgacgatctgatt
gtgctcgacaaaccggctggcatggtagtgcatccggcccccggcagtccagacggcacg
ctggtcaatgcgctgctggcctattgcggggagaacctgccaggaatcggcggagaaaag
cgccccggcattgtgcatcgtctggataaagatacctccggcgtcatggttgttgccaag
acagagtttgctctggcagccctttcagccctgtttgcggcacgtgatctggaaaggctg
tataccgcgctcgcatggggtgtccttacgccccgagaaggcgatattgaaggtgccatc
gggcgcgacccaagagatcgcaagcgcatggccattgtccgtcatggcggcaaacccgca
ctgacccattaccgcgccatggcaacatggtatgacgctgtcacacggatggaatgcaag
cttgcaaccgggcgcactcatcaaatccgcgtgcatctctccgcaaacggacatcccatc
atcggtgatccggtctatctgcgccgcattccagccgtcgcaaagagtctggatcaggat
gtcaaaaacgctttgctcgactttccccgccaggccctccatgccggcgtgctggggttc
agacacccacgaaccggtgaaaatctgcgtttcgagaccccattgccggaagatatgatg
agcctcatcgatttactcgatcataattcatag

DBGET integrated database retrieval system