KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0434Help
Entry
GbCGDNIH1_0434    CDS       T00392                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00300  Lysine biosynthesis
gbe00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GbCGDNIH1_0434
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GbCGDNIH1_0434
Enzymes [BR:gbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     GbCGDNIH1_0434
Peptidoglycan biosynthesis and degradation proteins [BR:gbe01011]
 Precursor biosynthesis
  Amino acid ligase
   GbCGDNIH1_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ABI61332
UniProt: Q0BV20
Position
complement(493567..494979)
Genome map
AA seq 470 aa AA seqDB search
MAGVHISGITADSRQVMPGWVFAALPGQKTDGRRFIADAVERGAAAILAPAGTAWPPGVP
PRPMIQDAEPRRLLALMAARLAGAQPHTIAAITGTNGKTSTADFLRQIWTLLGRSAASLG
TLGLIAEGFHPQDSLTTPDPVTLAQTLAMLARAGIQHTALEASSHGLDQFRLDGVRLSAA
AFTNLTRDHLDYHGTEAAYRTAKLRLFADLLPAGAPAIASPTLDQITLEALRGIARRRGL
RLIIAGSPDSPLPLLAIEPHAGGQYLTIREEGTTHRINVPLPGRFQADNIITAATIAASL
GKRGIVPLLSRLTGVRGRMEQAATLPNGAAIYVDYAHTPDALERLLDALRPHTSGKLHVV
FGAGGDRDPGKRPLMGEAARTHADRLIVTDDNPRSENPAKIRAAILAACPDAEEIGDRAE
AIAHAIRSLQPGDVLAIAGKGHEQGQTIGKTVHPFDDVSVARAIAAQVTS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgttcatatcagcgggattacggccgacagccgtcaggttatgcccggctgg
gtctttgccgctctgcccggccagaaaacggatggaagacgctttatcgccgatgccgtg
gagcgcggcgcggccgccattctggcacccgccggcacggcctggccgcccggcgttccg
ccccgcccgatgattcaggatgctgaaccgcgccgattgctcgccttgatggcggcacgg
ctggccggagcacaacctcacaccatcgcggccatcaccggcaccaacgggaaaaccagt
acggcggattttctgcggcagatatggactctgctgggtcgttctgctgccagcctcggc
acactcggcctgatcgcggaaggctttcacccgcaggacagcctgaccacgcctgatccg
gtgacactggcccaaactctggccatgctggcacgggccgggattcagcataccgcgctg
gaagcatcctctcacggtctggatcagttccgtctggatggcgtccggttatcggctgcc
gctttcaccaacctcacccgcgatcatctggattatcacgggaccgaagccgcctaccgc
accgccaagctgcgcctgttcgccgatctgctgcccgctggcgcgcctgccattgcctcc
cccacgctcgatcagatcacgctggaggcgctgcgcggtattgcgagacggcgtgggttg
aggctgatcattgcgggttcgccagactctccgctgccgctgctggcgatcgagcctcat
gccgggggacagtatctgaccatccgggaagagggcaccacacaccgcatcaacgtgcct
ctgccaggccgttttcaggcagacaacatcatcaccgccgccacgattgccgcctcgctc
ggcaaaagggggattgtgcctctgctgtcacgcctgaccggcgtgcgcggccggatggag
caggccgccaccctgcccaacggggctgcgatctatgtcgattacgctcatacccccgac
gctctggagcgtctgctggatgcgttgcggccgcataccagcggaaagctgcatgtcgtg
tttggggcgggcggagatcgcgatcccggcaaaagaccgctgatgggggaagcggcccgc
acccatgccgaccgtctgatcgtgaccgacgacaacccccgctcggaaaatccggcgaaa
atacgtgctgccattctcgctgcctgccccgatgccgaggaaatcggcgaccgggccgaa
gccattgcccatgccatccgcagccttcagcctggcgatgtgttggccattgcaggcaag
gggcatgagcagggccagaccatcggcaaaacggtgcatcctttcgacgatgtctcggtc
gcccgcgctatcgccgctcaggtgacgtcatga

DBGET integrated database retrieval system