KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0974Help
Entry
GbCGDNIH1_0974    CDS       T00392                                 

Definition
(GenBank) Gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00460  Cyanoamino acid metabolism
gbe00480  Glutathione metabolism
gbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GbCGDNIH1_0974
   00460 Cyanoamino acid metabolism
    GbCGDNIH1_0974
   00480 Glutathione metabolism
    GbCGDNIH1_0974
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gbe01002]
    GbCGDNIH1_0974
Enzymes [BR:gbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     GbCGDNIH1_0974
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     GbCGDNIH1_0974
Peptidases and inhibitors [BR:gbe01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   GbCGDNIH1_0974
CD molecules [BR:gbe04090]
 Proteins
  GbCGDNIH1_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABI61872
UniProt: Q0BTI0
Position
complement(1110262..1112067)
Genome map
AA seq 601 aa AA seqDB search
MTVTRKLRQVWDRLFFTKQSLARLAFCVAFIMPFSLAAETPAHRPSAPHSFPPLARDVTA
AHMMVVTANPFASRAALDVLKAGGNAIDAAVTAQAMLSLVEPQSSGLGGGAFLLYYDAAT
RQVTSWDGRETAPAAIPPTIFQDATGKPLPLDSAGIGGRAVGVPGALRMLEAVHKLHGQL
LWKDLFTSTITQAENGFPVSALMSREIREEQNSLMVQEAARTYFLPNGSVPEPGYILKNP
ALAETMRSVAEKGADALLTGRIATDIVTAIRQSPASGTMTMDDLASYQPRQRPALCMPVK
MRTVCSMGPPSSGGVAVLQILSMLEGFDLRHLRPDSAEAADLIIQAEHLAFADRNLFLAD
PDFVKIPLRGLLDPAYLRQRARMIHPRHAPSTVEAGNPSWSMPDLPPAQGTQPPKPEHGT
SHISIVDAQGNAVSMTTTVQDVFGSKLLVDGFILNDELTDFAFVPEEAGKPVANRVQAGK
RPRSSMAPIIVLDQNGKLDMVTGSPGGGHIISYVSQAMLLSMRWNLSPAQAISAPHIGTT
GLKSDLEAGTEATLLADRLLQYGHHPAIIRLNSGLSMIIKKADGHLTGAADPRRDGIPYG
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcacacggaaactgcggcaggtatgggacaggctgtttttcacaaaacaaagc
ctggcacggctcgcgttctgcgtggctttcataatgcctttttccctcgccgccgagaca
cccgcacatcggccctccgcccctcattcgtttcctccgctggcccgggatgtaaccgcc
gcccatatgatggtggtaacggccaacccgttcgccagccgggcagcattggatgtgctg
aaagcaggtggcaatgccattgatgccgcggttaccgcacaggcgatgttgtcactggtg
gagcctcagtcttccggtctgggtggaggcgccttcctgctgtactacgatgcagccacc
cggcaggttaccagctgggatggacgggaaaccgcccctgccgccatcccccccaccatt
ttccaggatgcgaccggcaaaccgctcccgctggacagcgccggaatcggaggacgcgcc
gtcggggtacctggcgcgctgagaatgctcgaagctgtgcacaagctgcatgggcagctg
ctctggaaagatttgtttaccagcaccattacccaggcggaaaacggttttccggtttct
gcactgatgagccgggaaatccgggaagaacagaacagcttgatggtacaggaagccgca
aggacttatttcctgcccaatggctcagttcctgagccgggttacatattaaaaaatccc
gctctggcagaaacgatgcggagcgttgccgagaaaggggcagatgccttgctgaccggt
cggatcgccaccgacattgtgacagcgatccggcaaagcccggcctccgggaccatgacg
atggatgatctggcctcctatcaaccccgtcagcgcccggccctgtgcatgcctgtcaaa
atgcggacagtgtgcagcatgggaccgccttcctccggaggtgtcgccgtcttgcagata
ctctcgatgctggagggcttcgatctgcggcatctgcgccccgacagcgccgaagcggcc
gatctgatcattcaggccgaacacctggcctttgcagatcgcaacctgtttctggctgat
cccgattttgtaaagataccactccgcggtcttctcgacccggcctatctccggcaaaga
gccagaatgatccatccccgccatgcgccctccacggtagaggcgggcaatccatcatgg
tccatgcccgacctaccccccgcccagggtacacagccaccaaaaccggagcacggtacc
agtcatatcagcatcgtcgatgcgcaaggtaatgccgtgtccatgacgaccacggtgcaa
gacgtatttggctccaagcttttggttgacggatttattctgaacgatgaactgaccgat
ttcgcatttgtgcctgaagaggcaggtaagcctgttgccaaccgggttcaggcgggcaaa
agaccacgcagcagcatggcgccaatcattgtgctggatcagaatggaaagctcgacatg
gttaccggatcgcccggaggtggccacattatcagctatgtcagtcaggccatgctgctg
tccatgcgatggaacctgtctcctgcccaggccatctcggctccccatatcggcacaacg
ggtctgaaatccgatctggaagcagggactgaagccaccttactggctgatcgcctgctc
cagtatggtcatcatcctgcgatcataaggctcaattcaggtctctccatgattatcaaa
aaagcagacgggcatctgacaggagcagccgatccacggcgggatggtattccttacgga
gaataa

DBGET integrated database retrieval system