KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1019Help
Entry
GbCGDNIH1_1019    CDS       T00392                                 

Definition
(GenBank) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  KO
K12506  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00900  Terpenoid backbone biosynthesis
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gbe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GbCGDNIH1_1019
Enzymes [BR:gbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     GbCGDNIH1_1019
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     GbCGDNIH1_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YgbB IspD NTP_transf_3 NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ABI61917
UniProt: Q0BTD5
Position
complement(1154573..1155703)
Genome map
AA seq 376 aa AA seqDB search
MRIAAILVAGGSGSRFGSDIPKQFLPVGGKPLIRHGAERLSAKVDLLQPVGCADDIAPLL
QGLDHLPIVDGGKERQDSVRAGLEALVPYAPDIVLIHDAARPYFPDHTIEDLIEALQIHD
GAIPAVPVADTLKRAAGNIIDSTVPREGLYRAQTPQAFKFSVLLALHRDHPGGATDDAAL
LDQAGHSVALVPGAEDNIKVTYPADLARVERSMSISMIPRIGTGYDVHAFETGRKLILCG
IEVPHHQGLAGHSDADVGIHALCDAIYGALAEGDIGRHFPPTEASWKDADSARFLRHAAE
RIAARGGFLANADLTLICEKPKITPHAPAMIARLAELLGVSIDKISVKATTSEKLGFTGR
EEGIAAQAAVIIMIPA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgcagcgattctcgtagctggcggcagtggctcacgcttcggcagcgatatt
cccaaacaattcttgccggtaggcggaaagccgctgatcaggcatggagccgagcgtctg
tcggcgaaggtcgatctgctgcaaccggtcgggtgtgctgacgatatcgcaccccttctg
cagggtctggaccatctaccgattgttgatggcggaaaagaacggcaggacagtgtccgt
gccggtttggaagctttggtgccctatgcacctgatatcgtactgatccatgatgccgca
cgcccctattttcccgatcacaccattgaagatctgatcgaggctctgcaaatccacgac
ggtgccattcccgccgtccccgtcgccgatacgctaaagcgtgcggcaggcaatattatc
gactcaaccgtccctcgcgaggggctgtatcgtgcccagacgccgcaggcgttcaaattt
tccgttctgctggcacttcaccgggaccatcccgggggcgcaaccgacgacgccgccctg
ctggatcaggccgggcattccgtggctctggtccccggggcggaagacaatatcaaagtc
acctatccggccgatctggcccgagtggagcgtagcatgtccatctccatgatcccgcgc
atcggcaccggttacgatgtgcatgccttcgaaacaggccggaagctgattctatgcggt
attgaggttccacatcatcagggactggccggacattcagatgctgatgtcggcattcat
gcgctgtgcgatgccatttacggtgcgctggctgagggagatatcggtcggcatttcccg
ccgaccgaagcaagctggaaagatgcggacagcgcccgcttcctgcgtcatgcggctgag
cgcatcgcggcgcggggcggttttctggccaatgccgatcttacgctgatctgcgaaaag
ccgaaaattacgcctcacgcgccggccatgatcgcccgtctggctgagctgctgggagtc
tccatcgacaagatttcagtcaaggcaacaaccagcgagaaacttggctttacgggccgt
gaggagggcatcgccgcccaggcggccgtgatcatcatgataccggcctga

DBGET integrated database retrieval system