KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1033Help
Entry
GbCGDNIH1_1033    CDS       T00392                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00480  Glutathione metabolism
gbe00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GbCGDNIH1_1033
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GbCGDNIH1_1033
Enzymes [BR:gbe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GbCGDNIH1_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABI61931
UniProt: Q0BTC1
Position
1165608..1166087
Genome map
AA seq 159 aa AA seqDB search
MTSLYDFQATMLDGQVVPLSRWRGQVALVVNTASRCGFTPQYQGLEALYQRFAASGFVVL
GFPCNQFGAQEPGSSEEIRTFCDTRYSVSFPMFARVEVNGTNAHPLFDYLTRQRRGLLGT
RRIKWNFTKFLIGRDGVPVARYAPSCKPEKLEKAVYRLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtctttatgattttcaggcgaccatgctggatgggcaggtcgtaccgctgtcg
cgctggcgtgggcaggtggcgctggtcgtcaatacggccagccgttgtggctttaccccg
caatatcaggggctggaagcgctctaccagcgttttgccgcttccggcttcgtggtgctg
ggtttcccgtgcaatcagttcggcgcgcaggagccgggcagcagtgaggagatcaggact
ttttgtgatacgcgctacagcgtcagtttcccgatgtttgcgcgggtggaagtcaatggc
accaacgcccatccgctgttcgattatctgacccgtcagcgccgcggcctgctggggaca
cggcgcatcaagtggaatttcaccaaattcctgattggacgggacggcgtgccggtggcc
cgctatgccccgtcctgcaagccggaaaagctggaaaaagcggtctaccggctactctga

DBGET integrated database retrieval system