KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1533Help
Entry
GbCGDNIH1_1533    CDS       T00392                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00540  Lipopolysaccharide biosynthesis
gbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    GbCGDNIH1_1533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:gbe01005]
    GbCGDNIH1_1533
Enzymes [BR:gbe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     GbCGDNIH1_1533
Lipopolysaccharide biosynthesis proteins [BR:gbe01005]
 Unusual sugar
  GbCGDNIH1_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ABI62431
UniProt: Q0BRX1
Position
1720911..1721900
Genome map
AA seq 329 aa AA seqDB search
MTALIILTGGAGFIGSNIAAELNEAGHTDTVIIDWLGTERKWHNIAKRRFADFVFPEDVD
GFLDGLKGADAVVHMGANSSTTATDGDEVIRSNFRLSCHLWNWCTATRTPFIYASSAATY
GDGSHGFVDDDSDAALDALHPLNLYGWSKHAFDKWALERARRHDAPPQWAGLKFFNVYGP
NEYHKKDMMSLVAKNTPSILNGQTIRLFKSHRPEFADGEQLRDFIYVKDCASVVSWLLQN
RHVSGLFNLGTGKARSFRDLMMAVGQAAGKTTSIEFIDMPASIRDQYQYFTEASMHKLRA
AGYTRDFYSLEEGVRDYVQTYLITQDPYR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgacggccttgattattttgaccggcggagcaggttttatcggctcaaacatcgcggcc
gaactgaatgaggcaggccacaccgataccgttatcattgactggctcggcaccgaacgc
aaatggcataatatcgccaagcggcgcttcgctgattttgtctttccggaagacgtcgac
ggctttctggatggtttgaaaggcgccgatgccgttgtgcatatgggggccaattcatca
accaccgccacagatggtgatgaggtcatccgctccaatttccgcctgtcatgccatctg
tggaactggtgcaccgctaccagaacgcccttcatctacgcttcatccgccgcgacctat
ggcgatggcagtcatggctttgtcgatgacgacagcgatgcggccctcgatgccctgcat
ccgctcaatctttatggctggtccaaacatgctttcgacaaatgggcgctggaaagggca
cgtcgtcatgacgctcccccgcaatgggccggtctgaagtttttcaatgtctacggcccc
aacgaatatcacaagaaagacatgatgagtctggtggccaaaaatacaccgtccatcctg
aatggtcagacgatccgcctgttcaaatcccaccggcccgaattcgcggacggagaacag
ttgcgtgacttcatctatgtcaaggactgcgcttccgtcgtcagctggctgctccagaac
cggcatgtcagcggattgttcaatctgggaaccgggaaagcccgttccttccgggatctg
atgatggccgtcggacaggctgccgggaaaacgacatccatcgagttcatcgatatgcca
gcttccatccgtgatcagtaccagtatttcacagaagcctccatgcacaagcttcgggcg
gctggttacacacgggatttttatagtctggaagaaggcgtgcgggattatgtgcagact
tatctgatcacgcaggatccataccggtaa

DBGET integrated database retrieval system