KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2014Help
Entry
GbCGDNIH1_2014    CDS       T00392                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00260  Glycine, serine and threonine metabolism
gbe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01130  Biosynthesis of antibiotics
gbe01230  Biosynthesis of amino acids
Module
gbe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GbCGDNIH1_2014
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GbCGDNIH1_2014
Enzymes [BR:gbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GbCGDNIH1_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABI62912
UniProt: Q0BQJ0
Position
complement(2259410..2260246)
Genome map
AA seq 278 aa AA seqDB search
MSRIQTRFAALKREGRGALIPFIEAGDPDAETSQTLLHGLPAAGADLIEIGVPFTDPMAD
GPTIQRAGRRALEAGATLAKTLAMVETFRQQDKDTPIILMGYLNPIETYGHERFCVDAAA
VGVDGLIIVDLPTEEADLILPFATANGLDVIRLVAPTTDDARLPHVLNGSSGFVYYVSIT
GITGTVTASAEQLAQNMPRLRRVTDLPVAIGFGIRNPAQAAEAVRQGDAAIVASALIDTL
AETLDDGRATDRTVPAVLDQVRQLAEAVRSARLSARGA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtatccagacgcgtttcgcggcgctgaagcgtgagggacgcggtgcgctgatc
ccgtttatcgaggcgggtgaccctgatgctgaaaccagccagacattgttgcatggcctg
ccggcagcaggcgccgatctgatcgagatcggtgtgccgttcaccgacccgatggcggat
ggtccgaccatccagcgcgccggacggcgtgcgctggaggcgggtgccacactcgccaaa
actctggcgatggtcgagaccttccggcagcaggataaggatacgccgatcattctgatg
gggtatcttaacccgattgaaacctacggccatgagcggttctgcgtcgatgccgccgcg
gtcggggtggatgggttgattatcgtcgatctgccgaccgaggaggcggacctgatcctg
cctttcgccaccgcgaacgggctggatgtgatcaggctggtcgcgccgaccacggatgac
gcacgtctgccgcatgtgctgaacggctcatccggtttcgtctattacgtcagtatcacc
ggcatcaccggcaccgtcaccgcgagtgcggagcagctggcgcagaatatgccgcgtttg
cggcgcgtgaccgacctgccggttgcgatcggttttggtatccgcaatccggcgcaggcc
gcggaggcggtgcggcagggagatgccgccatcgttgcttctgcgctgatcgatacgctg
gctgaaacgctggatgatggccgcgccactgatcgcaccgtgcctgcggtgctggatcag
gtccgccaactggccgaggctgtgcgcagcgcccgcctctccgcccgaggagcctga

DBGET integrated database retrieval system