KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2371Help
Entry
GbCGDNIH1_2371    CDS       T00392                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00620  Pyruvate metabolism
gbe00630  Glyoxylate and dicarboxylate metabolism
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01120  Microbial metabolism in diverse environments
gbe01200  Carbon metabolism
Module
gbe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GbCGDNIH1_2371
   00630 Glyoxylate and dicarboxylate metabolism
    GbCGDNIH1_2371
Enzymes [BR:gbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GbCGDNIH1_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABI63269
UniProt: Q0BPI3
Position
2636007..2638223
Genome map
AA seq 738 aa AA seqDB search
MNAITLATRSLLPSGLQIAPVLHRFVEEEAMPGTGITAEAFWAALAVALRTLGPANAALL
NQRNTLQAEINQWHRVHTLPQSGVGAALAAQSDAYRAFLHEIGYLLPPPAAFQVDTAQVD
DEIAHIAGPQLVVPVNNARYALNAANARWGSLYDALYGTDAVGRQQSATRGYDEARGAEV
IRHGRAVLDIAAPLAEGSHADAMLYAVHNGKLRIALANGHVTGLRDESGFCGYTGAPDAP
SRILLVRHGLHLEILFDRDHRVGRNDKAGIADLILESALSTIMDAEDSVAAVDAEDKVEV
YRNWLGLMRGDLTVRFEKNGAAVERSLHQDRVYTTPDGSGSLTLPGRSLLLIRNVGHHMM
TDAVMLDGAEVPETILDAFITSLIGLHDLRGRPGRHITNSRTGSLYIVKPKMHGPDEVAW
AARLFSTVEDALTLPRNTIKMGIMDEERRTSVNLAHCIEAVRSRVFFINTGFLDRTGDEI
HTSMEAGPMLRKNDMKQTAWFTAYENGNVDSGLACGLPGHAQIGKGMWAAPDNMAAMLAE
KIDHQRAGASTAWVPSPTAATLHALHYHQIDVAQRQATIAREGARTSLHALLTLPLLEEA
GKLTAQEIRDELDNNVQGILGYVVRWVDQGIGCSKVPNIYNVGLMEDRATLRISAQHIAN
WLRHGVVSREQVEETLRRMAVVVDGQNAGDPAYRPIAPAFDGPAFLAACDLIFKGTEQPN
GYTEFVLHRRRREAKART
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatcacccttgccacccgatcccttctgccctccggccttcagattgcgccg
gttctgcatcgatttgtggaagaggaagcgatgcccggcactggcatcacagccgaggca
ttctgggccgcactcgccgtcgccctgcgcacattggggcccgcaaacgctgccctgctc
aatcagcggaatacgttgcaggccgagatcaaccagtggcaccgcgtccatacgctgccg
caatccggcgtcggtgcggcactggcggcacaatccgacgcctaccgcgcgtttctgcat
gaaatcggctatctgctgccgccaccggccgcgtttcaggtcgataccgcacaggtggat
gatgagatcgcccatatcgccgggccacagctcgtcgttccggtcaacaatgcacgctat
gctctgaatgccgccaatgcgcgctggggcagcctgtatgatgcgttatacggcacagat
gccgtcggacgtcagcaaagcgcgacgcggggctatgatgaggcacgcggagccgaggtt
ataagacatggccgcgcggtgctggacatcgcagcccctctggccgaaggcagccatgcc
gatgccatgctctatgcggtacacaatggtaagttacggattgcgctggccaacggacat
gtgaccggactacgcgatgagtccggattctgcggatataccggcgcgcctgatgcaccc
agccgtattctgctggtcaggcacgggctgcatctggaaatcctgttcgatcgcgaccat
cgcgtcggtcgcaatgataaagccggtattgccgatctgattcttgaatcagccctgtcc
accatcatggatgcggaagactccgtcgccgcggtcgatgcggaggacaaggtcgaggtc
tatcgcaactggctgggtctgatgcgcggcgacctgacggtcaggttcgagaaaaacggc
gccgccgtcgaacgtagcctgcatcaggatcgggtttacactacgcctgatggcagcggc
agcctgacgctgcccggtcgatccctgctgctgatccgcaatgtcggtcatcacatgatg
accgatgcggttatgctggacggggcagaggtgccggagaccattctggatgcattcatc
accagcctgatcggcctgcatgatctgcgcgggcggcccggcaggcacatcaccaacagc
cgaaccggcagcctgtatatcgtgaagccgaaaatgcacgggccggatgaggtagcctgg
gcagcgcggctgttcagtacggtggaagatgcgctgactctgccccgcaacaccatcaag
atgggcatcatggatgaggagcgccggaccagcgtcaatctggcgcattgtatcgaagca
gtccgcagccgggtgtttttcatcaataccggctttctggaccgcaccggagacgaaatc
cacaccagcatggaagccggtcccatgctgcgtaagaacgacatgaaacagactgcgtgg
ttcacggcctatgaaaacggcaacgtggatagtgggctggcctgtggtctgcccggccat
gcccagatcggcaaaggcatgtgggcggcacccgacaacatggcggcgatgctggccgag
aaaatcgaccatcagcgcgccggggccagtacggcctgggttccttcccccacggcagcc
acgctgcacgcgctgcattatcatcagatcgacgtggcgcaacggcaggcgaccattgcc
agagaaggtgcccgcacctcactgcatgctctgctgaccctgccattgctggaggaggcg
gggaaactaaccgctcaggaaatcagggatgagctggacaataatgttcagggtattctg
ggctatgtcgtccgctgggtggatcaggggatcggctgctccaaagtaccgaacatctac
aatgtcggcttgatggaggaccgcgccacgctgcgcatttccgcacagcacatcgccaat
tggctgcgccatggtgtcgtgagccgggaacaggtcgaagaaacactgcgccgcatggcc
gtagtggtggatgggcagaatgcgggcgatcccgcctatcgacccatcgcaccagccttc
gatggacccgcctttctggcggcatgcgatctgatcttcaaaggcaccgagcagccaaat
ggctatacagagttcgtgctgcaccgccggcgtcgagaggccaaagcccggacctga

DBGET integrated database retrieval system