KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2423Help
Entry
GbCGDNIH1_2423    CDS       T00392                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00860  Porphyrin and chlorophyll metabolism
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GbCGDNIH1_2423
Enzymes [BR:gbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GbCGDNIH1_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABI63321
UniProt: Q0BPD1
Position
complement(2695872..2696636)
Genome map
AA seq 254 aa AA seqDB search
MSLPISSRIERPAILVTRPEPGASATARRLDALGFTPVLAPALEVEIRADALVEEALPDL
QAVLVTSANAIPALDPLRSLPLFAVGDATARAAQAAGHQDVTSAGKDADRLLMLVRARLD
PAGKPLLLASGEEQGAFLYQGLSQSGFTVLHRFVYCARPVQALPEQAEQALRILMEGAAP
SAGVAGLKAVLFFSPETARSFVRLLDRAGLADAASGLVACVISPAVVEAITALTWRDIRV
AAQPTQDDLLALLR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagccttccgatctcgtcccgcattgaacggcccgccatcctggttacccggcccgag
ccgggtgcttcggcgacggcgcgacggctggacgcactcggttttacgccggtgctggcc
cctgcgctggaggttgaaatccgcgccgatgcgctggtggaggaggcactgcctgatttg
caggcggtgctggtgaccagcgccaatgcgattcccgcgcttgatccgctgcgttctttg
cctctgttcgcagtaggggatgccacagcaagggcggcgcaggcggcaggtcatcaggat
gtgaccagtgccggaaaagatgcagaccgtctgctgatgcttgttcgtgcccggcttgac
ccggctggaaagccgctgctgcttgcctcgggagaggaacagggcgcgtttttgtatcaa
ggattgagccagagcgggttcaccgttctgcatcgtttcgtatactgcgcccgcccggtg
caggctctgcccgaacaggcggagcaggctctgcgcattctgatggaaggggctgccccc
tctgcgggggtggccggattgaaggcggtcctgttcttttcaccggaaacggcacggagt
ttcgtgcgtcttctggacagggccggattggccgatgcggcgtcggggctggtggcctgt
gtcatctcccccgcggtcgtggaggccatcactgctttaacctggagggatatacgtgtc
gcagcgcagcctactcaggacgatcttctggccctcctgcgatga

DBGET integrated database retrieval system