KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0112Help
Entry
GbCGDNIH2_0112    CDS       T03083                                 

Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00270  Cysteine and methionine metabolism
gbh00480  Glutathione metabolism
gbh01100  Metabolic pathways
Module
gbh_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GbCGDNIH2_0112
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GbCGDNIH2_0112
Enzymes [BR:gbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     GbCGDNIH2_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST GSP_synth ATPgrasp_TupA
Motif
Other DBs
NCBI-ProteinID: AHJ67098
Position
122830..123819
Genome map
AA seq 329 aa AA seqDB search
MAGGLRVAVQMDPMDSINIAGDSSFALMLEAQARGHALWHYEVRHMALREGGQRQGGSTG
ARLLARAHPVSVRRIDAAYYTFGPTEILDLATMDVVLMRQDPPFDMAYITATHMLEHIHP
RTLVVNDPAGVRNAPEKILVTHFPDLMPPTLVTWDVEAIRAFRAEHRDIVVKPLYGNGGA
GVFRVKEDDENLSSLLEMFFARSREPLMVQRYEAAVRQGDKRIILIDGEPVGAINRVPAA
GESRSNMHVGGRPEAAGLTARDREICAAIGPVLKERGLIFAGIDVIGNWLTEINVTSPTG
LQEIGRFDGVNLAARIWDAIESRKAALAA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcggcttgcgggtggcggtccagatggacccgatggacagcatcaacattgcc
ggcgacagcagttttgcgctgatgctggaggcacaggctcgtggccatgcgctgtggcac
tacgaagtccggcatatggccttgcgggaagggggacagcggcaaggtggctcgacaggg
gcacggctgctggcgcgggcacatccggtttcggtacggaggatcgacgcggcctattac
acgttcggcccgacggagattctcgatctcgcgaccatggatgtggtgctgatgcggcag
gatccgcctttcgacatggcctatatcaccgcgacccacatgctggagcatatccaccct
cgcacgctggtggtgaatgatccggcgggcgtgcggaacgcgccggagaaaattctggtc
acccattttcctgatttgatgccgccgacactggtgacatgggatgtggaggcgatccgc
gctttccgtgccgagcatcgggatatcgtggtcaaaccgctctacggcaatggcggggcc
ggggtgttccgggtcaaggaagatgatgaaaatctaagttctttgctggaaatgtttttc
gcccgctcgcgggagccactgatggtgcagcgctatgaagcggcggtgcggcagggggac
aagcgcatcatcctgattgatggggagccggtaggtgcgatcaaccgtgtgcctgccgca
ggggagagccgcagtaacatgcatgtcggtggccgtcctgaagccgcggggctgacggcg
cgggatcgggagatctgtgccgcgatcgggccggtgctgaaggagcggggcctgattttc
gcggggatcgacgtgatcgggaactggctgacggagatcaatgtcacctcgccgaccggg
cttcaggagatcggtcggttcgatggggtcaatctggctgctcgcatctgggatgccatc
gaaagccgcaaggcagcattggcggcctga

DBGET integrated database retrieval system