KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0447Help
Entry
GbCGDNIH2_0447    CDS       T03083                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00071  Fatty acid degradation
gbh00280  Valine, leucine and isoleucine degradation
gbh00310  Lysine degradation
gbh00362  Benzoate degradation
gbh00380  Tryptophan metabolism
gbh00620  Pyruvate metabolism
gbh00630  Glyoxylate and dicarboxylate metabolism
gbh00640  Propanoate metabolism
gbh00650  Butanoate metabolism
gbh00900  Terpenoid backbone biosynthesis
gbh01100  Metabolic pathways
gbh01110  Biosynthesis of secondary metabolites
gbh01120  Microbial metabolism in diverse environments
gbh01130  Biosynthesis of antibiotics
gbh01200  Carbon metabolism
gbh01212  Fatty acid metabolism
gbh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GbCGDNIH2_0447
   00630 Glyoxylate and dicarboxylate metabolism
    GbCGDNIH2_0447
   00640 Propanoate metabolism
    GbCGDNIH2_0447
   00650 Butanoate metabolism
    GbCGDNIH2_0447
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GbCGDNIH2_0447
   00072 Synthesis and degradation of ketone bodies
    GbCGDNIH2_0447
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GbCGDNIH2_0447
   00310 Lysine degradation
    GbCGDNIH2_0447
   00380 Tryptophan metabolism
    GbCGDNIH2_0447
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GbCGDNIH2_0447
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GbCGDNIH2_0447
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GbCGDNIH2_0447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gbh04147]
    GbCGDNIH2_0447
Enzymes [BR:gbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GbCGDNIH2_0447
Exosome [BR:gbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GbCGDNIH2_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHJ67462
Position
506389..507570
Genome map
AA seq 393 aa AA seqDB search
MEQPVILSAARTAIGRFGGGLSSVPAHQLGSVAIKAALERCGVAPEDVEEVILGQVLTAG
QGQNPARQAAIAAGIPVEHTAFGVNQVCGSGLRAVMLAAQQVMTGHARLMVAGGQENMSL
APHIAHLRNGTRFGDIQLVDTMIRDGLWDVFNGYHMGITAENVASAHGISRERQDLFALE
SHGRATRAMQAGVFREEIASVFLPGRHGTVEVNEDEHIRPDTTLEALAALRPGFSETGTV
TAGNASGINDGAAALVIASAAEASRRGLLPLARIVSFASAGVDPAMMGLGPVPASRKALA
LAGWRVADLDLIEGNEAFAAQACAVNALMGWDTARVNVNGGSIALGHPIGASGARVLVTL
LHEMQRRQVRRGLATLCIGGGMGVAMCIERLHS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcccgttatcctgagcgcggcccggaccgccattggccgcttcgggggcggc
ctgtcctctgttcccgcccatcaactggggtcggttgcgatcaaggcggcgctggaacgc
tgtggcgtggcgccggaggatgtggaggaagtcattctcgggcaggtgctgacggcgggg
caggggcagaatcctgcgcgtcaggcggcgatcgctgccggtattccggttgaacatacc
gcctttggcgtcaatcaggtctgtggctccggcttgcgggcggtgatgctggcagcgcag
caggtcatgactggccatgcccgactgatggtggcgggtggtcaggaaaacatgagtctg
gcccctcacatcgcccatctgcggaacggaacccggttcggtgacattcagcttgtcgat
acgatgatacgggacggtctgtgggatgtgttcaacggctatcacatgggcatcacggcg
gagaacgtagcatcggcccacgggatcagccgtgagaggcaggatctctttgctcttgaa
agtcatggccgggcgacccgggccatgcaggccggtgttttcagggaggaaatcgccagc
gtgttcctgcccggtcgtcacggcacggtagaagtcaacgaagatgaacatatccgccct
gataccacgctggaggccctggcggccttgcggcccggcttttccgaaaccggtaccgtg
acggcaggtaatgccagcggcatcaatgacggcgctgcggcgctggtgattgccagtgcg
gcggaggcgtcccgtcggggcctgcttccgctggcgcggattgtctcctttgcctccgcg
ggggttgatccggccatgatggggctgggaccggttcctgccagccgcaaggcgcttgcg
ctggccggatggcgggtcgccgatctggatctgatcgaggggaacgaagcctttgccgcg
caggcctgtgccgtcaacgccctgatggggtgggataccgcccgggtcaatgtgaatgga
ggctccatcgcgctcgggcatccgatcggggcatccggtgcccgtgtgctggtgacgttg
ctgcatgaaatgcagcgccgtcaggttcggcgaggtctcgccacactctgcatcggcggc
ggcatgggtgtggccatgtgcatcgagagactccatagctga

DBGET integrated database retrieval system