KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0654Help
Entry
GbCGDNIH2_0654    CDS       T03083                                 

Definition
(GenBank) Adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00860  Porphyrin and chlorophyll metabolism
gbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GbCGDNIH2_0654
Enzymes [BR:gbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     GbCGDNIH2_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AHJ67689
Position
complement(739274..740719)
Genome map
AA seq 481 aa AA seqDB search
MIQGTGSSVGKSLLVAGVSRALTRRGLVVRPFKPQNMSNNAAIAADGGEIGRAQALQARA
CRISPSHHMNPVLLKPQSEIGAQIVVQGKVHGQATARAYQAMKPQLLGTVLESFGILRKQ
ADIVLVEGAGSASEINLRAGDIANMGFARAANVPVVIAGDIDRGGVIAALVGTKTVLDPD
DAAMVRGFLVNRMRGDPSLFAEGMRLIEQQTGWEALGLVPHCEAARALPAEDAADLLRGL
SAPTRSGNTVIAVPMLPHIANFDDLDPLAAEDSVTLVMVPPGQPLPVADAIIIPGSKTVI
ADLAALRHHGWDIDILAHRRRGRSIIGLCGGYQMLGRAIHDPQGFEGPAGSAAGLGLLEI
ETVLEPHKILTSRSGHLFNHDVPVSGYEMHMGITTGAGLRRPLLSLGPDAPEGCVSADGV
VMGTYLHGLFHGGAFRRHLLATLDVSSHGGDHEDAVEHALDALADHMEAHVAIDRLLALS
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatacagggaaccggctcctcggtcgggaagtccctgctggtggccggggtgagccgt
gcactcacacggcgtgggctggtcgtgcgccctttcaagccgcagaacatgtccaacaat
gccgccattgccgctgacggtggtgaaatcgggcgggcacaggctctccaggcccgcgcc
tgccggatcagcccttcccatcacatgaatcccgtcctgctgaagccgcaaagcgagatc
ggcgcacagatcgtggtgcagggaaaagtccatggtcaggccacagcccgggcctatcag
gccatgaagccacagcttctggggaccgtgctggaaagtttcggcatcttgcggaaacag
gccgacatcgtactggtggaaggggccggcagcgcctctgaaatcaatctgcgtgcaggc
gacatcgccaatatgggctttgcccgcgccgccaatgttccggtggtcattgcgggtgac
atagatcgcggcggcgtcattgccgcgctggtcggcaccaaaaccgtgttggacccggac
gatgctgcgatggtgcgggggtttctggtcaatcgtatgcgcggcgatccatcgctgttc
gcagaaggaatgcgactgatcgaacagcagaccggctgggaagcgctcggactggtgccg
cattgcgaggccgcccgcgccctgccggccgaagatgccgccgatctcctgcgcggccta
tcagcaccgacacgatcgggaaacaccgtcattgccgtgccgatgctgccgcatattgcc
aatttcgatgatctcgatcctctggccgccgaagacagcgtgacactggtcatggtgccg
ccgggacagcccctgccagtggcggatgcgattatcattccgggatcgaaaaccgtgatc
gccgatctggcagctctccgtcaccatggatgggacatcgatattctggcgcaccggcgc
agaggacggagcatcatcggtctgtgcggaggctatcagatgctggggcgtgccattcac
gatcctcaagggtttgaaggtcccgccggcagcgccgccgggctggggctgctggagatc
gagaccgtgctggaaccgcataaaatcctgacctcccgcagcggtcatctcttcaatcat
gatgtgccggtcagcggctatgaaatgcatatggggatcacaaccggcgcaggattgcgg
cggcccttgctgtcgctcggtcccgatgcaccggaaggatgtgtttcagccgatggggtg
gtgatgggaacctatctccatggcctgtttcatgggggggctttcaggcgtcacctgctc
gcgacccttgatgtgagcagccatggcggcgatcacgaggatgctgtcgagcatgctctc
gatgctctggccgaccatatggaggcgcatgtcgctatcgaccggctgctggccctgtca
gcatga

DBGET integrated database retrieval system