KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_1416Help
Entry
GbCGDNIH2_1416    CDS       T03083                                 

Definition
(GenBank) Glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00860  Porphyrin and chlorophyll metabolism
gbh00970  Aminoacyl-tRNA biosynthesis
gbh01100  Metabolic pathways
gbh01110  Biosynthesis of secondary metabolites
gbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GbCGDNIH2_1416
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GbCGDNIH2_1416
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gbh01007]
    GbCGDNIH2_1416
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gbh03016]
    GbCGDNIH2_1416
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:gbh02048]
    GbCGDNIH2_1416
Enzymes [BR:gbh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     GbCGDNIH2_1416
Amino acid related enzymes [BR:gbh01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   GbCGDNIH2_1416
Transfer RNA biogenesis [BR:gbh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GbCGDNIH2_1416
 Prokaryotic type
   Other AARSs
    GbCGDNIH2_1416
Prokaryotic defense system [BR:gbh02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    GbCGDNIH2_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AHJ68771
Position
complement(1617734..1619077)
Genome map
AA seq 447 aa AA seqDB search
MVHVRFAPSPTGYLHVGNARIAVANALFALRYSGKFTLRLDDTDLERSRDEYAEAIAQDL
RWMGIEWADTFRQRDNMDRYEAAADALKASGRLYPCFESEEELRYKRELRLKQGRAPVYD
RAMLKMTPEQRAQAEANGKRPYWRFLLSDRTVGWRDGVLGPRQVKLQAISDPVVIRADGT
PLYTFTSVVDDIATGVTHIIRGEDHISNSGVQTDLFEALGKAAPALAHLPLLTDADGGKL
SKRIDSLTLRSLARDGIEPVALVSYLARLGSSRDPQPLTLAELAQEFDLDAFSASSARFD
GSQLAALNRRTLQTMPFSAVQDRLPQGATEAFWEAVRGNLDMLAEARLWWDVVAGSIVPP
VLTDEDNALLKQALPLLPQEPWDTTTWSVWTRAVKEASDRSGRALFRPLRLALTGEEHGP
ELAALLPLMGAERVRTRLTLTSGAMAG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatgttcgtttcgcgcccagcccgacgggctatctgcatgtcggtaatgcccgg
attgcagtagccaatgcactgtttgcgctgcgctattccggcaagtttactctgcggctg
gacgataccgatctggaacgctcccgcgatgaatatgcggaagcgattgcgcaggatctg
cgctggatggggatcgaatgggccgatacattccgccagcgcgacaatatggaccgctat
gaagctgctgcggacgctttgaaagcctccggtcgtctgtatccctgtttcgaaagcgag
gaagaactacgctacaagcgtgaattgcgtctgaagcagggacgtgccccggtttatgac
cgtgccatgctgaagatgacaccggagcagcgtgctcaggcggaagccaatggcaagcgg
ccctattggcggtttcttctgtccgaccgcactgttggctggcgcgatggcgtgctgggg
ccgcgccaggtgaagttgcaggcgatctccgatccggtggtgatccgtgcggatggcacg
ccgctttatacgttcacctcggtggtggatgatattgcaaccggtgtcacccacatcatc
cgtggtgaggatcatatcagcaatagcggtgtgcagactgatctgttcgaggcactcggc
aaggcggctcctgcgcttgcgcatctgccgctgctgacggatgcggatggcggcaagctc
tccaagcggatcgacagcctgaccctgcgcagtctggcacgggatgggatcgagccggtg
gcgctggtttcctatctggcgcggctcggctcctcccgcgatccgcagccattgacgctg
gcggaactggcgcaggagtttgatctggatgcgttttctgcttcctcggcccggttcgat
ggcagtcagctggccgcgttgaatcgccgcaccttgcagactatgccgttcagcgccgtg
caggaccgtttgccgcagggtgcgacagaagcattctgggaggctgtgcgcggcaatctg
gatatgctggctgaggcacgtctctggtgggatgtcgttgcgggcagcattgtgccaccg
gttctgacggatgaggataatgccctgctgaagcaggccctccctctgctgccgcaggag
ccgtgggataccaccacatggtctgtctggacgcgcgcggtgaaggaggcatcggaccga
tcgggccgcgccttgttccgtccgctccgtctggcgctgacgggggaggagcatgggcct
gaactggctgctctgctccccctgatgggggctgaacgtgtgcggacccgccttacgctg
acatcgggagccatggcgggatga

DBGET integrated database retrieval system